KEGG   Cryptosporidium hominis: Chro.40304Help
Entry
Chro.40304        CDS       T00210                                 

Definition
nitric-oxide synthase (NOS)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cho  Cryptosporidium hominis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 651 aa AA seqDB search
MPFFYINNVLNYLSICNISIGFILVLKKLAQLSSEYIENNVPSNFSIFYSTETGNSRKIS
ELFKKLLDEISIEANVREINSILEENMYLNSNNSVFVFVVSTCGNGNFPASSRKFIRYLS
KMIKSGNEIFLGTKYTIIGLGSSLYEYSFNSAAFKLDKLISSLKGEKYCEIALLDEVNGN
EIDFKTWWNNIFLNRLGISDSKEHLNKHFSIAVTRKKDEFVCKLKSINEISFYNHSLSGN
CHVSESYFKLIEFWPINRELLCETKTIDGIERQIFNLKLKLPDKVQYKTFDIIDILPPNL
DENIAFFSSKVLGINSIEDLKNITVEFVPINNMRRNISVPFPNNRSLMHILKYYFDLMTL
PPHSVMLQFVPYLNSIEGELISNESFFNENKDPYEFSFHLFINRFMKSLIPIPIEKFVKF
TGIRQYPRSYSISSSSLASPSMIDLTISTCIKGQIPAPLNEIISEGANRKNSKKIIKGLC
SSFLFEFDLNSPVLGMIRSSSLNIDNVASSALMFSHGSGIAPIRALLHERKYLINEKKII
KPAYLFYGCRTENEIIYKDELKDFKRIGALTEVFFALSKTQKKYVKDIIPFYKHIILKVV
DQNDSIIYICGKKEFVSGIKNEVASIISNNRSRNIIKKMFVEGRIFIESWN
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgccttttttttatatcaataatgtattgaactatctttcaatatgtaacatttctatt
ggattcattcttgttctgaaaaaactagcccaattaagttctgaatacatagaaaataat
gtcccatctaatttctcaatattttactcaacggaaacgggaaattcaagaaaaatatca
gaattgttcaagaaactactagatgaaataagcattgaagccaatgtccgtgagataaac
tcgatactagaagaaaacatgtatttaaatagtaataattcggtgtttgttttcgtagtt
tctacatgcggaaatgggaactttccggcttcgtcaaggaaattcattcgttatctttca
aaaatgataaaatctgggaatgaaatatttttaggaaccaaatacactattattggcctt
ggaagctccttatatgaatactcttttaattctgcggcttttaagcttgataaattgatc
tcttcacttaaaggtgagaaatattgcgaaattgcactcttggacgaagtgaatggtaat
gagattgatttcaaaacatggtggaacaatatatttttaaataggcttggaatttcagat
tcaaaagaacatttgaacaaacatttcagtatagctgtaacgagaaaaaaagatgaattt
gtttgcaaattgaaaagtattaatgaaatctcgttttataatcactctctctctgggaat
tgccacgtttccgaaagttacttcaagctaatagaattttggcctattaacagagaatta
ttatgtgaaacaaaaactatcgatggcattgaaagacaaatttttaacttaaaacttaaa
cttcctgataaagtacaatataagacatttgatattatcgatatacttccaccaaacctc
gatgaaaacattgcttttttttcaagcaaagtattgggaataaacagtatcgaagattta
aaaaatattactgttgaatttgtgccaataaataacatgagaagaaatatcagtgtccca
tttcctaataatcgctctttaatgcatatactaaagtattattttgatcttatgacttta
cctcctcactcagtaatgctacaatttgttccttatttaaattcaatagaaggagagctt
atttccaacgaaagtttttttaatgaaaataaggatccttatgagttttcttttcattta
tttataaatcgttttatgaaaagtcttattccaataccaatagaaaagtttgttaaattt
actggaatcagacaatatccaaggagctattcaatttcatcctcctcactcgcttcacca
tcaatgattgatttaacaattagtacgtgcattaagggccaaattcctgccccattgaat
gagataattagcgaaggggcgaatagaaagaattccaaaaaaattatcaaaggattgtgt
tcaagttttctttttgaatttgatttgaattcgcctgtactaggaatgataaggtcatct
tctctcaatatagacaatgtggcatcatctgcactgatgttttcacatgggagtggtatt
gcgcctattagagcactattacatgaacgaaaatatttaattaatgaaaaaaaaattata
aagccagcgtatttattttacggatgcagaacagaaaatgaaataatttataaagacgaa
cttaaggactttaaaagaataggtgcattaactgaagtattctttgctttgtctaagaca
caaaaaaaatacgttaaagacataattcctttttataaacacataattttaaaggttgtt
gatcaaaatgattcaataatatatatctgtgggaaaaaggaatttgtttcagggatcaaa
aatgaagttgcatcgatcatttctaataatcgttcgagaaatattattaaaaaaatgttt
gttgaaggtagaatttttatagaatcatggaattga

DBGET integrated database retrieval system