KEGG   Cryptosporidium hominis: Chro.40506Help
Entry
Chro.40506        CDS       T00210                                 

Definition
chain A, crystal structure of Dhfr
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
cho  Cryptosporidium hominis
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cho00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cho00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cho00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 521 aa AA seqDB search
MSEKNVSIVVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKCDSNKKNALIMGRKTWD
SIGRRPLKNRIIVVISSSLPQDEADPNVVVFRNLEDSIENLMNDDSIENIFVCGGESIYR
DALKDNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVYMSQTFCTKNISYDFMIFEKQEK
KTLQNCDPARGQLKSIDDTVDLLGEIFGIRKMGNRHKFPKEEIYNTPSIRFGREHYEFQY
LDLLSRVLENGAYRENRTGISTYSIFGQMMRFDMRESFPLLTTKKVAIRSIFEELIWFIK
GDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGPIYGFQWRHYNGEYKTMHDDY
TGVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYVTNDNCLSCNL
YQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHLTQLKEQLSRT
PRPFPQLKFKRKVENIEDFKWEDIELIGYYPYPTIKMDMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaacgtttcaattgttgtggcagcttctgttttgagcagtgggatagga
attaacggacaattaccttggtctatatctgaggatttgaaatttttttcaaagataact
aataataaatgtgactcgaataagaagaatgcactaattatgggaagaaaaacatgggat
tcaattggaagaagacctcttaaaaatagaataattgtcgttatttcctccagcttacca
caagatgaagccgatcctaatgttgttgtatttagaaaccttgaagactcaatagagaat
cttatgaatgatgactcaattgagaatattttcgtctgtggtggtgaatccatatacagg
gatgctttaaaggataactttgtagatagaatatacttaacaagggtggcactagaagat
atagaatttgacacttatttcccagaaatacctgagacattcttaccagtatatatgtct
cagacattctgtactaagaatatctcttatgattttatgatttttgaaaaacaagaaaaa
aaaactttacaaaattgtgaccctgccagaggtcaattaaagtccattgatgatacagtt
gatcttcttggtgaaatatttgggattagaaaaatgggaaatagacacaagtttccaaaa
gaagaaatctacaacactccaagtattcgattcggaagagaacattatgagtttcagtac
ctggaccttctttctagggtcttagagaatggagcttatagggaaaataggacaggcatt
agtacatattcaatatttggtcagatgatgagatttgatatgagagaatcttttccactt
ttgactacaaaaaaagttgcaatcagatccatttttgaggagttaatatggtttattaag
ggagatactaatggaaatcatttgattgagaaaaaagtttatatttggtcaggaaatggc
tcgaaagaatatttggaaagaattggtttagggcatagagaggagaatgatttgggcccg
atctatggttttcagtggagacattacaatggagagtacaaaacgatgcatgacgattat
accggagttggagttgatcagcttgcaaaacttattgagaccctaaagaataacccaaag
gatagaaggcatatactaacagcctggaatccatctgccctatctcaaatggctcttccg
ccttgccatgtgctttctcagtattatgttaccaatgataattgtcttagttgcaacctt
tatcaaaggagttgtgacttgggattaggatctccatttaacattgcatcttatgctata
cttaccatgatgcttgctcaagtttgtggttatgaaccaggtgagcttgctatttttatt
ggagatgcccatatctatgaaaatcacctaacacaattaaaagaacaattaagccgcact
ccacgtccatttccacaactcaaattcaaaagaaaagttgaaaatattgaagactttaaa
tgggaagacatcgaattaatcggatattatccatatcccactattaaaatggacatggcg
gtataa

DBGET integrated database retrieval system