KEGG   Cryptosporidium hominis: Chro.50371Help
Entry
Chro.50371        CDS       T00210                                 

Definition
serine/threonine kinase-1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Chro.50371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 647 aa AA seqDB search
MDQRTKFRNGLNYINVNNKYNEISRNMNGNEYMNSYYADDYIDLPQNSRKRTYYESRRTG
IKHRKNEINNTYSGNRNIINNSNSGINTSRINLMPEYEYETLYVASTEKQLDNINYSNDG
NGYYQKRYYGNNNNNINMNMNINTNNCDNNNDNNHDITNYGLKPGYNIMLHSKNVNNNIN
GNYYHKYYDNSEIKKRRGLSSASGMLKYKDIGINEYRSYDSRGSSITYYNNSNKKVRYSD
DSLDYSQDNELSREYRNRNNNNNNNNSNNNNMNIINNNNNTNSDEIEHFQWYVGQYLTSR
YRILDIIGEGTFGRVFECEDLKRKRKVAIKVIRDVQRYTSAAKIEAEILRDINMEDKFGE
YSYCVMLYNAFLFNNSNMCLVFEKLGPSLFDFLDGNCSRGFFLADIQNISEQFLLALSFL
RKMKLTHTDLKLENILFTDNNYIWVNAPRHPGALIRRPVRPEIRLIDFGAATYEHDYHGS
VINTRQYRAPEVILDLGWDMSSDMWGFGCILMELYTGVLLFKTHEHMEHLAMVERIIEPF
PDYMLKKAYNSSKSGKKYVNRLKISNNINHHQNEEYKYVLNWPEGSSSNTSIKRVNDCRP
LENLVHKKHIMLAKFIRYILRPDPNLRPTPEMALRHEFFRYKFEEEI
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaagaacaaaattcagaaatggattaaactatattaatgttaataataaatat
aatgaaatatccagaaatatgaatggtaatgaatatatgaatagctattatgcagatgat
tatatagatttaccacaaaatagtagaaaaagaacttattatgaaagtagaagaacagga
attaaacatagaaagaatgaaataaacaatacatactctggaaatagaaatattattaat
aattcaaattctggtattaatacttctagaataaatttaatgccagaatatgaatatgaa
acactatatgttgcatccacagaaaaacaattagacaatataaattatagtaatgatggt
aatggttactatcaaaaaagatattatggaaataataataacaatataaatatgaatatg
aatataaatactaataattgtgataataataatgataacaatcacgatataacaaattat
ggattaaaacctggatataatattatgttacatagtaaaaatgttaataataatattaat
ggtaattattatcataagtattatgataatagtgaaattaagaaaagaagaggattaagt
agtgcaagtggaatgttaaaatataaagatataggaattaatgaatatagatcatatgat
tctcgtggttcttcaattacatattataataattctaataaaaaagttagatattcagat
gattcattagattattctcaagataatgaattatctagagaatatcgtaatagaaataat
aataataataataacaacagtaataataataatatgaatattattaataataataataat
acaaattcagatgaaatagaacattttcaatggtatgttggacaatatttaacttcaaga
tatcgtatattagatattataggagaaggtacttttggaagagtttttgaatgtgaagat
ttaaaaagaaaaagaaaagttgcaataaaggtaataagagatgtacaaagatatacatca
gcagcaaaaattgaagcagaaattcttagagatattaatatggaagataaatttggtgaa
tattcatattgcgttatgttatataatgcatttttatttaataactcaaatatgtgtctt
gtatttgaaaaacttggaccaagtttatttgattttttagatggtaattgttcaagagga
ttctttcttgctgatattcagaatatttcagaacaatttttattagctttatctttttta
agaaagatgaaattaactcatactgatcttaaacttgagaatatattatttactgataat
aattatatatgggtaaatgctccaagacatcctggtgcattaattagaagaccagtacgt
cctgaaattagattgatcgattttggtgcagcaacttatgaacatgattatcatggtagt
gttattaatacaagacaatatagagctcctgaagtaattttagatttaggatgggatatg
tctagtgatatgtggggttttggttgtattttaatggaactttatacaggtgtattacta
tttaaaactcatgaacatatggaacatttagctatggttgaaagaattattgaaccattt
cctgattacatgcttaaaaaagcttataatagtagtaaatctgggaaaaaatatgttaat
agattaaaaatcagtaataatattaaccaccaccaaaatgaagagtataaatatgtttta
aattggccagaaggaagttcaagcaatacttctattaaaagagtgaatgactgtagacct
cttgagaatttagtacataaaaagcatattatgttagccaaatttattagatatattttg
agaccagatcctaatttaagacctacccctgaaatggctctaagacatgaatttttcaga
tataaatttgaagaagaaatttaa

DBGET integrated database retrieval system