KEGG   Cryptosporidium hominis: Chro.50503Help
Entry
Chro.50503        CDS       T00210                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cho  Cryptosporidium hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Chro.50503
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro.50503
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Chro.50503
Enzymes [BR:cho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Chro.50503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 409 aa AA seqDB search
MTDNTYLNNFPDSNGYFGKYGGKYVPEVINNAMKEIEDAYNKISKSEDFINELKKIRKEF
QGRPTPIYYAKNLTKKYGGAEIYLKREDLNYTGAHKLNHCMGEALLAKYMGKKKLIAETG
AGQHGVALATAAAYFGLECEIHMGEVDVKKEYPNVIRMKILGAKVVCVEFGDKTLKEAVD
SAFEAYIKDIDNTFYAIGSVVGPHPFPKMVRDFQSIVGIESREQFIEMNGDGILPDIVTA
CVGGGSNAMGIFSGFISDKQVELICVEPLGKGNKIGEHAASITYGSEGIMHGFNSIMLKD
EEGNPSKVHSIASGLDYPSVGPEIAYLNSIGRTKTVCITDQEAINGFFELSRTEGIIPAI
ESSHAIGYVLKIAKEMKGKKILINLSGRGDKDLDCVYKIMDMVIINIIK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacagataatacttatttaaataatttcccagattcaaatggttattttggtaaatat
ggtggaaaatatgtacctgaagtaattaataatgcaatgaaagaaatagaagatgcttat
aataaaataagtaaaagtgaagattttattaatgaattaaaaaaaattagaaaagaattt
caaggaagaccaacaccaatatattatgcaaaaaatttgacaaaaaaatatggtggtgca
gaaatatatttaaaaagagaagatttaaattataccggtgcacataaattaaatcattgt
atgggagaagcattattagcaaaatatatgggtaaaaaaaaattaatagcagaaacagga
gcaggacaacatggtgtagcattagcaacagcagcagcatattttggtttagaatgtgaa
atacatatgggagaagtagatgtaaaaaaagaatatccaaatgtaattagaatgaaaata
ttaggtgcaaaagtagtatgtgtagaatttggtgataaaacattaaaagaagcagtagat
tcagcatttgaagcatatataaaagatatagataatacattttatgcaataggttcagta
gtaggaccacatccatttccaaaaatggtacgtgattttcaatcaattgtaggtatagaa
tcaagagaacaatttatagaaatgaatggtgatggtatattaccagatattgttacagca
tgtgtaggtggtggtagtaatgcaatgggtatatttagtggttttatatcagataaacaa
gtagaattaatttgtgttgaaccattaggtaaaggaaataaaataggtgaacatgcagca
agtataacatatggtagtgaaggaataatgcatggatttaattcaataatgttaaaagat
gaagaaggaaatccatcaaaagtacatagtatagcaagtggtttagattatccaagtgta
ggtccagaaattgcatatttaaatagtattggtcgtacaaaaactgtttgtattacagat
caagaagcaattaatggattttttgaattaagtagaacagagggtataataccagcaata
gaatcaagtcatgcaattggatatgtattaaaaatagcaaaagaaatgaaaggaaagaaa
attttgataaatttgagtggtagaggagataaagatttagattgtgtgtacaaaattatg
gatatggtaataattaatattatcaaataa

DBGET integrated database retrieval system