KEGG   Cryptosporidium hominis: Chro.50503Help
Entry
Chro.50503        CDS       T00210                                 

Definition
tryptophan synthase
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cho  Cryptosporidium hominis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cho01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cho00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cho00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 409 aa AA seqDB search
MTDNTYLNNFPDSNGYFGKYGGKYVPEVINNAMKEIEDAYNKISKSEDFINELKKIRKEF
QGRPTPIYYAKNLTKKYGGAEIYLKREDLNYTGAHKLNHCMGEALLAKYMGKKKLIAETG
AGQHGVALATAAAYFGLECEIHMGEVDVKKEYPNVIRMKILGAKVVCVEFGDKTLKEAVD
SAFEAYIKDIDNTFYAIGSVVGPHPFPKMVRDFQSIVGIESREQFIEMNGDGILPDIVTA
CVGGGSNAMGIFSGFISDKQVELICVEPLGKGNKIGEHAASITYGSEGIMHGFNSIMLKD
EEGNPSKVHSIASGLDYPSVGPEIAYLNSIGRTKTVCITDQEAINGFFELSRTEGIIPAI
ESSHAIGYVLKIAKEMKGKKILINLSGRGDKDLDCVYKIMDMVIINIIK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacagataatacttatttaaataatttcccagattcaaatggttattttggtaaatat
ggtggaaaatatgtacctgaagtaattaataatgcaatgaaagaaatagaagatgcttat
aataaaataagtaaaagtgaagattttattaatgaattaaaaaaaattagaaaagaattt
caaggaagaccaacaccaatatattatgcaaaaaatttgacaaaaaaatatggtggtgca
gaaatatatttaaaaagagaagatttaaattataccggtgcacataaattaaatcattgt
atgggagaagcattattagcaaaatatatgggtaaaaaaaaattaatagcagaaacagga
gcaggacaacatggtgtagcattagcaacagcagcagcatattttggtttagaatgtgaa
atacatatgggagaagtagatgtaaaaaaagaatatccaaatgtaattagaatgaaaata
ttaggtgcaaaagtagtatgtgtagaatttggtgataaaacattaaaagaagcagtagat
tcagcatttgaagcatatataaaagatatagataatacattttatgcaataggttcagta
gtaggaccacatccatttccaaaaatggtacgtgattttcaatcaattgtaggtatagaa
tcaagagaacaatttatagaaatgaatggtgatggtatattaccagatattgttacagca
tgtgtaggtggtggtagtaatgcaatgggtatatttagtggttttatatcagataaacaa
gtagaattaatttgtgttgaaccattaggtaaaggaaataaaataggtgaacatgcagca
agtataacatatggtagtgaaggaataatgcatggatttaattcaataatgttaaaagat
gaagaaggaaatccatcaaaagtacatagtatagcaagtggtttagattatccaagtgta
ggtccagaaattgcatatttaaatagtattggtcgtacaaaaactgtttgtattacagat
caagaagcaattaatggattttttgaattaagtagaacagagggtataataccagcaata
gaatcaagtcatgcaattggatatgtattaaaaatagcaaaagaaatgaaaggaaagaaa
attttgataaatttgagtggtagaggagataaagatttagattgtgtgtacaaaattatg
gatatggtaataattaatattatcaaataa

DBGET integrated database retrieval system