KEGG   Cryptosporidium hominis: Chro.60023Help
Entry
Chro.60023        CDS       T00210                                 

Definition
protein disulphide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Chro.60023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 481 aa AA seqDB search
MIGIRSLVSAAFLGFSCLSKVVLGGDEAHFISEHITSLTSSNFEDFVKSKEHVIVTFFAP
WCGHCTALEPEFKATCAEISKLSPPVHCGSVDATENMELAQQYGVSGYPTIKFFSGIDSV
QNYSGARSKDAFIKYIKKLTGPAVQVAESEEAIKTIFASSSSAFVGRFTSKDSAEYAVFE
KVASGHREHNYAFIAFFQEGEQKLEVLHKDEEPVSLPMPKTVEELEAKISIMNVPLFSAI
SAENYSLYMSREGYTAWFCGTNEDFAKYASNIRKVAADYREKYAFVFLDTEQFGSHATQH
LLIEKFPGLVIQSVNVPSIRYMYGPAKFDSVEPLKEFMKQVSEGKHELSIKSEPIPAEQS
GPVTVVVGKTFEEIIFRSDKDVLLEIYAQWCGHCKNLEPIYNQLGEEYKDNDKVVIAKIN
GPQNDIPYEGFSPRAFPTILFVKAGTRTPIPYDGKRTVEAFKEFINEHSSFPQEKESRDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaattagaagcttggtttcagcagcatttttaggtttttcttgtctctccaag
gtagtcttgggtggagatgaagctcacttcatttcagaacacattacttctttaacttcc
tccaacttcgaagacttcgttaagagcaaggaacacgtaattgttactttctttgcccca
tggtgcggccattgtactgctttagagccagaattcaaggcaacatgcgccgaaatctca
aagctttctcccccagtacattgtggtagtgttgatgcaactgaaaatatggagcttgca
caacaatatggtgtgagcggatacccaaccatcaaattcttcagtggtattgacagtgtt
cagaactattcaggagcaagaagcaaggatgcattcatcaagtatattaagaagttgacc
ggaccagcagtccaagttgctgagtccgaagaagctatcaagacaatcttcgcatcttct
tcttcagcctttgttggaagattcacctctaaggactcagctgagtatgctgtcttcgag
aaagttgctagtggtcaccgcgagcacaactatgctttcattgctttcttccaagaaggt
gaacaaaagctcgaggtattacacaaggatgaggagccagtttctctcccaatgccaaag
actgttgaagagttggaggccaagatatccataatgaatgtcccattgttctctgcaatt
agtgctgaaaactactccctctatatgtcaagagaaggttacactgcctggttctgcggt
actaacgaggacttcgccaagtatgcttcgaatattagaaaagttgcagctgattacaga
gagaagtatgcctttgttttccttgatactgagcaatttggttcccatgccactcaacat
ctcttgattgagaaattcccaggtttggttatccaaagtgtcaatgttccatcgattaga
tacatgtatggtccagctaaattcgactctgttgagccattaaaggaatttatgaagcaa
gtttctgaaggcaagcacgaactcagcattaagtctgagccaatcccagctgagcaatct
ggtccagtcactgttgttgttggtaagaccttcgaagaaattattttcagaagtgacaag
gatgttcttttggaaatctatgcccaatggtgtggacactgcaagaacctcgagccaatc
tacaaccaactcggtgaagagtacaaggacaacgacaaggttgtgattgcaaagatcaac
ggaccacaaaacgatatcccatatgaaggtttcagtccaagagccttcccaactatcttg
ttcgtcaaggccggaactagaacaccaattccttatgatggaaagagaactgttgaggcc
ttcaaggaattcatcaatgaacattcatccttccctcaagaaaaggaatctcgtgacgaa
ctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system