KEGG   Cryptosporidium hominis: Chro.60132Help
Entry
Chro.60132        CDS       T00210                                 

Definition
initiation factor e4
Orthology
K03259  
translation initiation factor 4E
Organism
cho  Cryptosporidium hominis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Chro.60132
Translation factors [BR:cho03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Chro.60132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 240 aa AA seqDB search
MTEKEVVSKYLSFNESIEPNLTLPTACSEVDLPEDLISRPLPLSHEWIVWEQLNVETRKD
LDYSNATKPVARFSSVQQFWWLWHNIPQPSELLKGKRMIRESSDGSKSVVDAVILFKEGI
QPMWEDPMNATGGHIHFRAWQSSVVPGELDTMWNNLVLAVIGGSLENSSIVNGIRLVDKL
GGNKGNIRVEIWFSDFSNQSAHQALLKEIETLMSSLLDGTSCEPPHFEVKSHSKSKPDTN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaagaagtagtttcaaagtatttgtcctttaatgagtctatagagccaaac
ttgacacttccaacggcctgtagtgaagttgatttaccagaggatttaatatctaggcca
ttaccgttatctcatgaatggattgtatgggaacaattaaatgtggagacaagaaaagat
ttagactactcaaatgcaacaaagccagttgccaggttttcatcggttcaacagttttgg
tggctttggcataatattcctcagccttctgagttattaaagggaaaaagaatgattaga
gaatcatcagatggttcaaagagtgtagtagatgcagtgattttatttaaagaaggtatc
caaccaatgtgggaagatccaatgaatgcaactggtggtcatattcactttagagcttgg
caatcatcagtagttcctggagaattagatacaatgtggaataatttggttttggctgtg
ataggaggaagtttggagaactcttctatagttaatggaattagattggttgataaactt
ggaggtaataagggtaatattagagttgagatatggttttcagatttttcaaatcaatca
gcccatcaagcacttcttaaggaaattgagactttaatgagtagtttgttagatggtaca
tcttgtgagcctcctcattttgaagttaaatctcattcaaagtcgaaacccgatacaaat
taa

DBGET integrated database retrieval system