KEGG   Cryptosporidium hominis: Chro.60173Help
Entry
Chro.60173        CDS       T00210                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Chro.60173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 432 aa AA seqDB search
MGAKKKIAYFYDEEVGNFHYGLGHPMKPHRVRMTHDLVSQYGLLEKVDVMVPTPGTVESL
TRFHSNDYVDFLRSVNTDNMHDYSDHLARFNVGEDCPVFDGLWEFCQLSAGGSLGGAQSV
NELGYQYAINWAGGLHHGKKHEASGFCYVNDCVLGALEFLKYQHRVCYVDIDIHHGDGVE
EAFYTSPRCMCVSFHKYGDYFPGTGALNDVGVEEGLGYSVNVPLKDGVDDATFIDLFTKV
MTLVMENYRPGAIVLQCGADSLSGDRLGCFNLSLKGHGHAVSFLKKFNVPLLILGGGGYT
LRNVPKCWTYETSLIVDTYIDEQLPNSSNFYGYYGPDFSLAVRTSNMENLNSRQDCEEIY
RKISENFRDYVFPIGSQISAYDIPEKLPLLYNPNKTPDDYKDGNNIKHEQHQDFDDEMKE
WPTVDYNNRAIG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggagccaagaagaaaatagcatatttctatgacgaggaagttggcaatttccactat
ggcttgggccatccaatgaaaccgcatagagttagaatgacccatgaccttgtttctcaa
tatgggttattagaaaaagttgatgttatggtaccgacccctgggacagtcgagtctttg
acaaggtttcattcgaatgactatgtagactttttacgtagcgttaatactgataatatg
catgactattctgatcacttagctagattcaatgtaggtgaagactgccctgtatttgat
ggcctgtgggaattttgtcagttgtctgccggaggatcacttggaggggctcaatctgtt
aatgagttgggatatcaatatgcaataaactgggcaggaggactccaccatggaaaaaaa
cacgaagctagtggtttttgttatgttaatgattgcgtattgggcgctttagagtttttg
aaatatcaacatagagtttgttatgttgatattgatatccatcatggagatggggttgaa
gaagctttttatacttctcctagatgtatgtgcgtttcatttcacaagtatggtgactac
tttccaggaactggagcactgaatgatgtaggagtggaagaaggtcttggatattccgtg
aatgttcctttgaaagacggggttgatgacgcaacttttattgacttgtttactaaagtt
atgacactggtaatggaaaattatagaccgggggcaattgttttacagtgcggagctgac
tcactatcaggagatagactaggttgttttaacctatcacttaagggacatgggcatgcc
gtttcttttttaaagaaattcaacgtcccattgcttattttgggaggtggtggttacaca
ctcagaaatgttccaaaatgctggacttatgaaacaagtttaatagttgacacatatatt
gacgaacagcttcctaattcatcaaatttctatgggtactatggacctgatttttcctta
gcagttagaacttcaaatatggaaaatctaaactcaagacaagattgtgaagaaatttat
aggaaaataagtgaaaacttcagggattatgtgtttccaatcggatctcaaatatcagca
tacgacatacctgagaagctccctctcttatataatccaaacaagactccagatgactat
aaagatggcaacaacattaagcacgaacagcatcaggatttcgatgatgagatgaaagaa
tggcctacagttgattacaacaacagggctattggatag

DBGET integrated database retrieval system