KEGG   Cryptosporidium hominis: Chro.60381Help
Entry
Chro.60381        CDS       T00210                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cho  Cryptosporidium hominis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Chro.60381
Enzymes [BR:cho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Chro.60381
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Chro.60381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1030 aa AA seqDB search
MSTRGVLQKYNMKSLKEQKIDTTLSGKQKTECKVKSSSKFTGEVLITSKNISSPTQSLEK
SDSLPVSSSDNSRIESSVPTAANSPTSYSSSMASIPDERGDIYEALDRVPDDGKILDHDL
HLLNKALHPEPFGVLGYQKFGDDGQYEYYVVRAWVRNARRIQIKAIDYSFSSIGTNNTPV
EMEQRYIDGNPSWMFEKAFKTLKEKIPTCRTHFCGYDENLENSNIENKRIGNQSNKDDYS
TDKFSDVGSEANNKVNKNTIVSKKKEITADCNSIMEKTYSNVIVNTLNKSKTNLVSNKES
HKGNEMPKLELNQSNLMSSNIPRNKNIRSEACSSDEACNCYVHDNINSQECVRKLYYELL
VEYNGDDSGKVYAIRDTYSFGLLLSNGDMELFQSGSCWHVDNILGSHIIEYNGVKGVRFS
VWAPHAKYVRVVGDWNSWDGRVNPMRFRHGVGIWELFIPHLGPGEKYGYEIHSQSNDVFV
KIDPYSQEYEVPPRYASIISACDDSYKDETDRFRWEDQEWIKRREQLGSKGEMRRQPMSI
YEVHLPSWMRRENGDYLGYREIAERLVEHVKNLNFTHVEFLPLAQHPFEGSWGYQVTGQY
APYSRLGTPDDFKYLVNELHKAKIGVFIDFVPAHFCKDAWGLVYYDGTPTYEYGDPREGE
HKQWGTAVFNFRRNEVRSFLLGAAYHWLRRYHIDGLRIDAVSSMLYRNYLRPNGEWIPNE
FGGDANLEAVSLLQELNWVIHKEFPGVFTMAEESTAWQGVTHKDGGLGFDAKWDLGWMND
TLSYLYTPPDNKSSKHNKLTFRGLYMSHEHWVLPLSHDEVVNGKGSLLDKCGFTGAPYMD
RIRTLKTLFGYQVGMPGRPLLFQGAEIAQGREWKENRSVDWHEGEEDVRKKVCIFLSDLL
AVYKNNVSLHAGDDESWNFQWVDCENSQDCIIAFLRKYKEWYNDVVVICNFSSRRYNHYP
IGVPHGKEWLVMLNSDDWKYGGAMFGPGNNSTVHASHGGRVGWDYCLWIDIPEFSCMYLK
PLFNPNENDS
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaagaggagttttgcaaaagtataacatgaagtcattgaaagaacaaaagatt
gacacaacattatcggggaaacaaaagactgaatgtaaagtaaaaagcagcagcaaattt
acaggcgaagtattgataacaagtaagaatatatctagcccaacacagagtctggaaaag
agtgattcactacctgtttcatcaagtgataattctaggattgaaagtagtgttccaact
gcagcaaatagtccaacttcatattcaagttcaatggcttcaattccagatgagcgaggc
gatatttacgaagccttggatagagttccagatgatggaaaaattctggaccatgattta
catcttttaaataaggctttacatcctgaaccatttggtgttcttgggtaccaaaagttt
ggtgatgatggtcaatacgaatattatgtcgttagagcatgggtcaggaacgctagaaga
attcagataaaagcaattgactattcattttcttctattggtactaacaatacgcctgtt
gaaatggaacaaagatatattgatggtaatccaagttggatgtttgagaaagcttttaaa
acacttaaggaaaagatacctacttgtagaactcacttttgtggatatgacgagaatttg
gagaattctaatattgaaaataagagaattggaaaccaaagcaataaggatgattattca
accgataagttttcagatgttgggtctgaagctaataataaagtaaacaaaaatacgatt
gtttctaagaaaaaagaaattactgccgattgtaattcgattatggaaaaaacatattct
aatgttattgtaaatactctgaataaatcgaaaactaatttggtttcgaacaaggaatcg
cataaaggaaatgaaatgcctaagcttgaattgaaccaatcaaacttgatgtcttcaaat
attccgagaaataaaaatattagaagtgaagcatgcagttcagatgaagcttgtaattgt
tatgtgcatgacaacattaactctcaagagtgtgtgagaaaattatattacgaattgctt
gttgaatacaatggggatgattctggtaaagtctatgctattagagatacctattcgttt
ggattactactatcaaatggtgatatggagcttttccaatctggtagttgttggcatgtc
gacaatattctaggttcccatattattgaatacaatggagtaaaaggggtaaggttctca
gtttgggccccccatgccaaatatgttcgtgttgttggagactggaattcttgggatgga
agagtaaatcccatgcgatttcgtcatggtgttggaatctgggagttgtttattccgcat
ctaggcccaggggagaagtatggatatgaaatacactctcagtcaaacgatgtgtttgtt
aaaattgatccatattcacaagaatatgaggttcctccacgatatgcttccatcattagt
gcttgtgacgattcatacaaagatgagactgaccgttttcgctgggaggatcaagaatgg
ataaagagaagagaacaattgggttccaaaggtgagatgagaaggcaaccaatgtcaatt
tacgaggttcatcttccaagttggatgaggagagaaaatggagactacttgggatataga
gagattgcagagagacttgttgaacacgttaaaaaccttaactttactcacgttgagttc
ctccctcttgctcaacatccatttgaaggaagctggggatatcaagtaactggacaatat
gctccatatagtcgtttaggtactcctgatgattttaaatacttggttaacgagcttcac
aaggccaagattggagtctttattgactttgttcctgctcatttttgcaaggatgcttgg
ggattggtatattatgatggaactccgacttacgaatatggtgatccaagagaaggtgaa
cacaagcagtggggaactgctgtattcaactttagaagaaatgaagttcgttcatttttg
cttggagctgcttaccattggttgcgtcgttaccatattgatgggctaagaattgatgct
gttagctcaatgttatacagaaattacttaagaccaaatggtgagtggatccccaatgag
tttggaggagatgcaaatcttgaagctgttagcctcctacaagagcttaactgggttatt
cataaagaattccccggtgttttcactatggctgaggaaagtactgcttggcagggagtt
acacacaaggacggagggcttgggtttgatgctaaatgggacttgggatggatgaatgat
actctaagttatttgtacactccccctgataataaaagcagtaagcataataagcttaca
tttagagggctttacatgtctcatgaacattgggttttgccattaagccacgatgaagtc
gttaatggaaagggaagtttacttgataagtgtggattcactggagcgccttatatggat
agaattaggacattaaaaacgctatttggatatcaggttggaatgcctggccgtcctttg
cttttccaaggggctgaaattgctcaaggtagagagtggaaagagaatagatccgttgat
tggcatgaaggagaggaggacgtgagaaaaaaagtctgtattttcctaagtgatttatta
gctgtttacaagaataacgtcagtctccatgctggagatgatgaatcctggaatttccaa
tgggtagattgtgaaaactctcaagattgtattattgcttttcttagaaagtacaaagaa
tggtataacgatgtagtggtcatttgtaactttagctcaagacgatacaatcattatcca
attggagttcctcatggaaaggagtggcttgtcatgcttaattcggatgattggaagtat
ggaggagcaatgtttggtcctggaaacaactccactgttcatgcttcccacggagggaga
gttggctgggattattgtctctggattgacatacccgagttctcttgtatgtatttaaag
cctttatttaatccaaatgaaaatgattcataa

DBGET integrated database retrieval system