KEGG   Cryptosporidium hominis: Chro.60521Help
Entry
Chro.60521        CDS       T00210                                 

Definition
ubiquitin-specific protease
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Chro.60521
Peptidases [BR:cho01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Chro.60521
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Chro.60521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 920 aa AA seqDB search
MNELFEEYLKLIVSKIERKDPVYKAQCQLSFKDSFSEGGLYVNLKNFEAYSRDFLEWDHN
QSGCRLYLSIKGTRKYHSENIDNPTNLSIGKEEGYFPEKSFFEDLFQYGLVSFPDMEVME
LTDSRVHKELSEKLNYIIQYDQNMELSKDTDSLVAWAEERKVSRHAENLFQVSSPKQISP
KGWTCETCGASTNLWLNLSDGFIGCGRRLYGVGGGCFDGKDEGAALLHYQQHTERPLAVK
LGTITQFGNADVFSYDPQEDDLVLDPHLVKHLSVFGINVGQLEKTEKSLTEMQIEQNNKL
DLTSGTESEECGSFLPMNKLFKKGDLLTTLVGLENSGNSCYVNVVLQLLASIPEVGELFS
IHFQDLLEIYSKYFIQKTRPRESIVIQFSKVIKALLTNDVINDRNYKISSRSEDIQKAIS
ELKEKGINENIIESLTESEVNPCLVHILPSILKRTISKGNPEFSSSHQQDTLEYFTFLQE
KLSDDLKKYYNHSSQEIQKLIQQFINLFSFFIGERLECKQTGSVKLTSQLNNVLSLPIPK
DLITYSSDTRQIKKPKHAFGEDGEDLATPKSNNVKEEQDMSDDHECFSDISLLLSNWRQE
EIVENFLSPCTNQLGKAGKSNFIKSMSKYLIIHMQRFYLSEDWRPKKINLSVKVPNFLDL
ESLRDSEELKPGEKPFPEGVDEVNKSLKEEVQVPESLVNSVLDLGFTKSHAELAVKNTFS
TDIDICINWILTNIDSINSMDLTSSDSSSSSSSSSSNTSKTNNSASHQDLEAIKNIISIC
CCSRDIAEKAFKISNQNLERAIQMIFDDPSIIESFEDTQLQQVSVGPDLSSKLIELDDGP
GKYELIGVICHLGKSVHSGHYICYNKRKIDSSINPSSQPTESSCPSSLWVRFNDTKVYLS
KEDDFPHKEKGYIYLYRRTN
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactttttgaggagtatttgaagcttattgtaagcaagatagaaagaaaggat
ccggtttacaaagcacaatgtcaattgtcatttaaggattctttctctgaaggggggctt
tacgttaatttgaagaactttgaagcatatagtagggattttcttgaatgggaccataat
cagagtggctgtaggctttacttgagtattaaaggcactaggaaatatcactcagaaaat
attgataatcccacaaatttgtcaataggcaaagaggaaggatactttccagagaagtca
ttttttgaggacttattccaatacggtttggtatcttttccagatatggaagtgatggaa
ttgacggatagccgggttcataaagaactttctgaaaagcttaattatataatccaatac
gaccagaacatggaattaagcaaagatacggactctttagttgcctgggctgaagaaaga
aaagtttcaaggcatgctgagaatctttttcaggtatcttcccctaagcaaatttctcct
aaaggttggacatgtgagacttgtggagcaagtacaaatttatggttaaatttatcagat
ggatttattggatgtggaagaaggttatatggagttggaggtggttgctttgatggaaag
gatgaaggagcggctctactccattatcaacaacatacagaaagacctttggcagttaag
ttgggaacaataactcagtttggaaatgcggatgtattttcctacgatccacaggaggat
gatttggttctggatcctcatctagtaaaacatctttcagtatttggaataaatgttggg
caacttgaaaagactgaaaaaagtttaacagaaatgcaaattgagcagaataacaagtta
gatttgacaagtggaacagaatctgaagaatgtggtagttttttaccaatgaataaacta
tttaaaaaaggtgatttactaacaactcttgtaggacttgagaactctggtaactcttgt
tatgttaacgtagttttgcaacttcttgcatctattccagaagtaggagagcttttttca
atccattttcaagatttactggaaatttactcaaaatattttattcaaaaaacaaggcca
agagaaagcattgtaattcagttttctaaagtaattaaggctttacttacaaatgatgta
attaatgatcgtaattataagatttcatctcgttctgaagatattcaaaaagctatttcc
gagcttaaagagaaaggtattaatgaaaatatcattgaatctttaacagaaagtgaagtc
aatccttgtttagtgcatattcttccttcaatactgaaaagaactatttctaaaggtaat
cctgagttttcttcatcccatcagcaagatactcttgaatattttactttccttcaagaa
aagctatctgatgatcttaaaaagtattataatcattcttcacaggaaattcagaagtta
attcaacaatttattaatcttttcagtttcttcattggagaaagacttgaatgtaaacaa
acaggatctgttaagcttacttctcagttaaataatgtattatcactaccaatacctaag
gatttaattacttatagttcagacactaggcaaatcaaaaagccaaaacatgcctttggt
gaggatggtgaagatttagctactcctaaatctaataatgttaaagaagaacaagatatg
agtgatgatcacgaatgttttagtgatatttccctcttactttccaattggaggcaagaa
gagatagtagaaaattttctctctccttgtacaaatcaattgggtaaagctggaaaatcg
aattttattaaatccatgtcaaaatacctcattatacatatgcaaagattctatttatca
gaagattggagacctaagaaaattaacttaagtgttaaagtcccaaatttcttagattta
gaatctttaagagattctgaagagctaaaacctggtgaaaagcctttccctgaaggagta
gatgaagttaataaatctttaaaagaagaagtccaggttccagaatctctggtgaattct
gttttggatttgggattcaccaaatcacatgctgaactggctgttaagaataccttctca
acagatatagatatatgtattaattggatactgacaaatattgactcaatcaattccatg
gatttgacttcatccgattcatcatcatcttcttcctcatcttcctcaaatacttccaaa
accaataattcagcatctcatcaggatctagaagctatcaagaatattatttcaatatgt
tgttgttcaagagatattgcagagaaggcattcaaaatttcaaatcaaaacttagagaga
gctatccaaatgatttttgatgatccttcaattattgaaagttttgaagacacacaatta
caacaagtatcagttgggccagatctttcttcaaaactcatagaacttgatgatggacca
ggaaaatatgaattaattggagttatttgccatctaggaaaaagtgttcatagcggacat
tacatatgttataataaaagaaagattgattcctctattaatccatctagccagccaaca
gaatcgtcctgtccttcctctctatgggtaagatttaatgatacaaaagtttatttaagt
aaagaggatgattttccccataaggaaaaagggtatatctatctttatcgcagaactaac
taa

DBGET integrated database retrieval system