KEGG   Cryptosporidium hominis: Chro.60529Help
Entry
Chro.60529        CDS       T00210                                 

Definition
mRNA export protein
Orthology
K14298  
mRNA export factor
Organism
cho  Cryptosporidium hominis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Chro.60529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 333 aa AA seqDB search
MNSSLLAASSWDKSVTVWEVQHMGGNSVNTRFGKFLISPKVFNDLLIVFIGASFQHSAPV
LDCAISSDSRYLFSGGCDNELKMHDMSSRQSQTIGRHDAPISNIFWCDEQKFVVTGSWDK
TIKFWNGQSQNPIYSLSIPERVYAMDLKYPALVVAAADNAVYVWNLQNITPTPYKRIQTQ
LKLQPRSISLFPDRTGFAIGSIEGRCAIAHIEESHRDKNFPFRCHRVTSSSPDIAYSINS
IDFHLQYGTFATGGSDGAIAFWDKDNKSRLTIMKTMPAPVTDIKFSPSGKLLAYSLSYDW
SKGYDNTAINNSCNKVLLHVMNDEHVCPKGKRS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttctctattagctgcatcttcttgggataaatccgtcacagtttgggaggta
caacatatgggcggaaattctgtcaacactcggtttggtaagtttctgatttcccctaaa
gtctttaatgacttactaattgtctttataggagcttcttttcagcattctgcaccagtt
ttggactgtgccataagttcagatagcaggtatctcttttctggaggatgcgataatgag
cttaagatgcatgatatgtcatcaagacaaagtcaaacaataggaagacatgatgctcct
atttctaatatattctggtgtgatgaacaaaagtttgtggtaacaggaagctgggacaaa
accatcaaattctggaatggacaatctcagaatccaatttattctctaagtataccagag
agagtatatgcaatggacctcaagtatcctgccttggtagttgcagcagcagataatgca
gtatatgtctggaatctccagaatattactccaactccttataagagaattcaaacccag
cttaagcttcaaccaagatcaatatctcttttcccagatagaacaggttttgctattggc
tcaattgaaggtagatgtgctattgcccacatagaggagtctcatagagataagaacttc
ccttttagatgtcatagagtcacaagtagcagccctgatattgcttattccataaacagc
attgattttcatctacagtatggaacgtttgctaccggagggagtgacggtgctatagcc
ttttgggataaagataacaaatccagattaacaatcatgaagacaatgccagctcccgta
actgatattaaatttagtccgtctgggaaactccttgcatattctctaagctatgattgg
agcaaaggatatgataatactgcgattaacaacagctgcaacaaagtcttattacacgta
atgaatgatgagcatgtatgtcccaagggaaaacgtagctag

DBGET integrated database retrieval system