KEGG   Cryptosporidium hominis: Chro.70018Help
Entry
Chro.70018        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cho  Cryptosporidium hominis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 423 aa AA seqDB search
MDDTNPNKRVKLNEEPNSQLSIPIKIDNVLNKILLHPCETLSDFIENKVGSYSPYYAHHF
FHNEEIALLDGYNTLIHIYFSCNWFDVYVEVDLTPIKSKSKEHIELSEEDKNYYIENIIK
QLKTIPLEGGFCSKEEFMERLKIPLLWVPGTSAGIFKAGLGDEGLEEVDLRKIDLSETEN
LTSCLNKEPNNSKPHPDVKNFQILHRRIEWFLHWYIESASSIDQEDRWAVWLPTVKREQS
LIILGLITTYLFFSIPKSRIRISQVLIFPQYQGKGLGCSFLDIIYSFAIKDEDIMEITVE
DPALSMMQLRDILTIEILLRNHVIKKNSLKPLKTDELLKILQNPNGSVNILKDVAMTCFP
SQTWEEVKEKIHKYTKESPRQIARLLVLISFFRYLPNPLPKIESNIEDEIRGFRVRKGKL
KII
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatgatacaaaccctaataaacgagtaaagctcaacgaagagcctaactcacagcta
tccattccaattaaaattgataatgtattgaataaaattttacttcatccatgtgagaca
ttgagcgactttattgaaaataaagtaggatcatattctccatattatgctcatcatttt
tttcacaatgaagaaattgcgttgctagatggttataacacgctaattcacatttatttc
tcttgcaattggtttgatgtatatgtggaagtagatttaactccaataaaaagcaagtct
aaagagcatattgagttaagtgaggaggacaagaactactatatagaaaatattattaag
cagttaaaaaccattcctctcgagggtggattttgctctaaagaagaatttatggaaaga
ttgaagattccattattatgggttcctggaacatcagcaggcatatttaaggcagggctt
ggagatgaagggcttgaggaagtggatttaagaaaaatagatttatctgaaaccgaaaat
ctgacttcttgcctaaataaggaacccaataattctaagcctcatcctgatgttaaaaac
tttcaaattctacacaggagaattgagtggttcctccattggtatattgaatctgcttct
tccattgatcaagaagataggtgggcggtttggctccctactgtcaaaagagaacaatca
cttatcattttaggtttaattactacatatttatttttttcaattcctaaatctagaatt
agaatttctcaagttttgatatttcctcagtaccaaggaaagggtttaggttgttcattt
ctggatattatttatagctttgcaataaaagacgaagatataatggaaattactgtagaa
gatccagccctttcaatgatgcaacttcgtgatatattaactattgaaattttactaaga
aatcatgtaattaaaaagaattctttaaaaccattaaaaactgacgaacttttaaaaatt
cttcaaaatccaaatggatcagtaaatattttaaaagatgtggcaatgacgtgttttcct
tctcaaacttgggaagaagttaaagaaaagattcataagtatacaaaagagtcgccaaga
caaattgcaagattacttgtattaatatcattctttagatatttaccaaatccattaccc
aagattgaatccaatattgaagacgagatcaggggtttcagagtaagaaaaggtaagttg
aaaattatttga

DBGET integrated database retrieval system