KEGG   Cryptosporidium hominis: Chro.70170Help
Entry
Chro.70170        CDS       T00210                                 

Definition
P42251
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cho  Cryptosporidium hominis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Chro.70170
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Chro.70170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 463 aa AA seqDB search
MPSIFWIYLTFHLFIGVFAEDSSSEKLLKSLVFISCVDGQKQDKSGNYVSQEYWKAIQSD
KPDALFWMGDSVYTKCGSPVCVSKGYLVQSNNSFYRDLLKTGLFVDGTWDDHDYGVNDGG
KYVAFKDESQQLFLDFISLPKDSPRRNRKGVYSSHTFGPPGKQIKVIILDTRYHRDNYYL
HERYGISSFAYLDTPFTSIFAASLRFFASIFGYGHSYQGDMLGKEQWDWLEKELSNSKAL
ANIIISSVQVTTQYPIVEGWGHFPKSRERLFSLIKKTKPKGLFFLSGDVHWGQIFESNDS
QNSLVEITSSGMTHSVSDRILDSFVISTTLPIFTGWSLNDKSPNYFIRENYGKLDFEYLC
TDSKECSGITVKATIRDLNGDIQLKKIFKFDNESNENHIEAISRIPQMIVEKSAKQIFGR
LCIIIVSIIWGIQIAIVFLYFILRIITSFTRLFSKKNSKAKSE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcatattttggatatatttgacttttcatctattcattggagtatttgcagaa
gacagcagctctgagaaacttttgaaatctttagtttttatcagctgtgtggatggccag
aaacaagataaatcaggtaattatgtaagccaagagtattggaaagcaattcaatctgac
aaaccggatgctttattttggatgggagattctgtttatactaaatgtgggtctccagta
tgtgtaagtaagggataccttgttcaaagtaataattcattttatagagaccttttgaag
actggtttatttgttgatggtacttgggacgatcacgattatggtgttaacgatggtgga
aaatacgttgctttcaaagacgagagtcagcaactatttttagactttatttctcttcct
aaggattctccaagaagaaataggaagggtgtttactcgtcacatacttttggtcctcct
ggaaagcaaattaaagtaattatcttggacacaaggtatcatagagataattattacctt
cacgaaagatatggtatttcatctttcgcttatttggatactccatttaccagtattttt
gcagcatctcttcgtttctttgcatctatttttggttatggccattcatatcaaggagat
atgttgggaaaggagcaatgggattggttagagaaagaacttagtaactctaaggctctt
gctaatattattatctcatctgtacaagttaccacacaatacccaattgttgaaggctgg
gggcattttccaaagtctagagagagattgttttcgcttattaagaagacaaaaccaaaa
ggactattctttttatctggggatgtccactggggtcaaatctttgagtctaacgattct
caaaattcattagttgaaattacttcaagtggaatgactcatagcgtaagtgaccgaatt
ctggatagttttgttatttctacaacattaccaatctttacgggctggtctttgaatgac
aagtctccaaattactttattagagaaaactatggaaaacttgactttgagtacttatgt
acagattctaaagaatgttcagggatcacagttaaggccactattagggacttgaatgga
gatattcagctaaagaagattttcaaatttgataatgaaagtaatgaaaatcatatcgag
gctatttctagaattccacaaatgattgttgaaaaatcagcaaaacagatatttggtaga
ttatgcataataatcgtctcaatcatttggggtattcagattgccatcgtcttcttatac
ttcatattacgtataatcacgtcattcacaagactcttttcaaaaaaaaatagcaaagca
aagagtgaataa

DBGET integrated database retrieval system