KEGG   Cryptosporidium hominis: Chro.70200Help
Entry
Chro.70200        CDS       T00210                                 

Definition
histone H2B variant 1
Orthology
K11252  
histone H2B
Organism
cho  Cryptosporidium hominis
Brite
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Chro.70200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 131 aa AA seqDB search
MSGKSGKSIKGPAQKQQAAKKTAGKSPADGGKRKRRKRTESFALYIYKVLKQVHPETGIS
KKSMSIMNSFINDVFDRLSAEAVKLVQYNKKRTLSSREVQTSVRLMLPGELSKHAVSEGT
KAVTKYTSASA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaagtggtaaatcaattaagggaccagcccagaagcagcaagcagcaaag
aagactgcaggaaagtctccagcagacggtggcaagagaaagagacgtaagagaacagaa
tcctttgctctttacatctacaaggttttgaagcaggttcatccagagactggtattagt
aagaagagcatgagtatcatgaactcttttataaatgatgtttttgatcgtctctcagct
gaagctgtcaagttggttcagtataacaagaaaaggactttatcaagcagagaagttcag
acttcagttagattaatgcttccaggtgagctctcaaagcatgcagtctctgaaggaact
aaagctgttactaaatacacctctgcatctgcttaa

DBGET integrated database retrieval system