KEGG   Cryptosporidium hominis: Chro.70250Help
Entry
Chro.70250        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cho  Cryptosporidium hominis
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Chro.70250
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Chro.70250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 198 aa AA seqDB search
MKDILVICGPSGVGKGTLISHLMKEFPDKFGFSISHTSRSPRGKESNGVEYYFCSNEEFI
NMISMDASRPLACVSFSSSAPPPRLPRPPCPLLPSLPGRGSFVLPPVPLSASPPSPPPPP
PLSPLPPPAFLSLFFARARCVPPLLRPPLGRTLPPSLFSASXLGAVPACASRPSFRPAFS
PLSPSRVLLALGQYTTEK
NT seq 595 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattctagtcatttgtggcccgagcggagtggggaagggaactttgatttct
caccttatgaaagagtttcctgacaagtttgggttttcaatttcccatactagtagaagc
cccaggggaaaagaatctaatggggtagaatattatttttgttcaaacgaggaatttata
aacatgatatctatggatgcgtctcgccccctcgcttgcgtgtctttctcctcttccgcc
cctcctccccgtctccctcgccccccctgccccctcctgccctccctccccggccgcggt
tccttcgtccttcccccggtgccgctctccgcctctcccccttcgcccccccctcccccc
cccctctcccccctccccccccctgccttcctctctctcttcttcgcccgcgcccggtgc
gtcccccctctgctgcgccctcccctcggccgcaccctccctccctcgctcttttctgcc
tctnggctcggcgctgtcccggcgtgtgcttctcgtccttctttccgccctgccttttct
ccgctttccccctcccgtgtcctgcttgccctcgggcagtacacaaccgaaaaat

DBGET integrated database retrieval system