KEGG   Cryptosporidium hominis: Chro.70303Help
Entry
Chro.70303        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cho  Cryptosporidium hominis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Chro.70303
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Chro.70303
Protein phosphatases and associated proteins [BR:cho01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Chro.70303
Transcription machinery [BR:cho03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Chro.70303
Spliceosome [BR:cho03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Chro.70303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 320 aa AA seqDB search
MTPQPSSTTISGTTNGSNNDIDVDSIIAKLLEVRGSRPGKPVQLTEKEIRGICIKSREIF
MSQPTLLELDAPIKICGDIHGQYYDLLRLFEYGGFPPDTNYLFLGDYVDRGKQSLETICL
LFAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIID
EKILCMHGGLSPELHKLDQIRKIERPTDVPDTGLLCDLLWSDPEKDVRGWGENDRGVSFT
FGHDVVEKFLRDHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD
ETLMCSFQILKPVEKKKLKP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacaaccttcatctactacaatatcaggaactacgaatggttctaataatgat
attgacgtagactcaataatagcaaagctattagaggtgcgaggttctcgtccggggaag
cctgttcaacttacagagaaagagatacgcggaatatgtattaaatctcgtgagatattt
atgagccagcctactttacttgaattagatgcacctattaaaatatgtggagacatacat
ggacaatactatgacttacttagactttttgagtacggtggtttcccaccagacactaat
tatttgtttcttggagattatgtagatagaggtaaacagagcttggaaactatatgcctt
ttgtttgcatacaaaataaaatatccggagaatttttttttattgagaggaaatcatgag
tgtgcatctatcaatcgaatttatggattctacgatgaatgtaaaagaaggtataatgta
aagctttggaagacttttacggattgttttaattgcttacccgttgctgccataattgat
gagaagattctttgtatgcatggcggactttctcctgaattacataaattggatcaaata
agaaagattgaaaggcctacagatgttccagacacgggcttgctttgcgatttgttgtgg
tctgatcctgaaaaggatgtaagaggatggggagaaaatgataggggtgtatcattcaca
tttggccacgatgtggttgagaaatttctgagagatcatgatatggatcttatctgcaga
gctcatcaagtggtagaggatggatatgaattttttgccaaacgacagttggtcaccctt
ttttctgcccctaattactgtggagaatttgataatgcaggtgcaatgatgtctgttgat
gaaacgttaatgtgttctttccagattttaaagcctgtagagaaaaagaaacttaaaccg
taa

DBGET integrated database retrieval system