KEGG   Cryptosporidium hominis: Chro.70411Help
Entry
Chro.70411        CDS       T00210                                 

Definition
nuc2+ and bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cho  Cryptosporidium hominis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Chro.70411
Protein phosphatases and associated proteins [BR:cho01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Chro.70411
Ubiquitin system [BR:cho04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Chro.70411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 791 aa AA seqDB search
MEDELLSILTYLDRWQLYDNIRFWAEVIDKLLESKEARIQISRFLVKDLNLQEAFNYLKV
ECDKAKLQLGSNEDSINKEVNLYGDYLTIKCCYLMGRIDEAERMILKICSKPLTELADSC
LISPSVSPKSWKGTPVTNEKKKSLSSIFSTICMNPTMLIKYIHTGELKIPGDSAGLYLWG
NILEELDAKVSALYCYAIALDWNPVLWKSFQKLVGLSCQYPHELVKICCCLNNWGEKHLE
YVGTNSDALVISTVYKNEAECWQVKNIQDGNLLISISDKSDSEELYVLNVSDFFYNVGDT
LQKRHMLRYHSFTNWLENPVKDGNSGPKWPYSEFEDVKNANHKFSSSNISEINYNSVANT
ENIDENIKPLVSRFHPLISMIQLLSKFTHQMEWYLCHSFLKNIESIPNKISEMGYVRELH
VRALFESNQWQECINVCKCINYETNYNLWIKCLDIYSSCLWQLSRSIDLINLSNLTLKII
EKNTPQLWIVVGNCFSLHKEYESSIKCFKRAIQYDNRYVYAYTLIGHELSIIEKYDEAIQ
MYQKALKIDPRCHRAHWGIGYVWFKREEYYQAKSHFNLALKVVPNNSTLIHYLGLCYLTT
HDFLSAYNTFQKGILKDQRNPWLKYHAGIVLLELERYEEALTMLTAAHRLASNEPNIHLY
LGKTFSHLGRKDKALRHLNIAFDLTKDINEKQIILNLMKELENGSNIEGRYCKSNETNRS
GRISNSGAGYSSGSKLLSSFRNHHYFPIRNDPPNPFIHHQIQQEHNIPQTVPSPAVSGGH
SLLLTLMPGNN
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgagttattgtccattttaacctaccttgatagatggcaattgtatgacaat
attagattttgggctgaagtaatcgacaaattattggaaagtaaggaagcaagaattcaa
atatctagatttcttgtaaaggatttgaatttacaggaggcttttaattatttgaaggta
gaatgcgataaagcaaaattacaattgggttctaatgaggattcaataaataaagaagta
aatttatatggtgattatttaactattaaatgttgttatttaatgggaagaattgatgaa
gcagagcgtatgatccttaaaatttgctcgaaacctctgacagagcttgctgatagttgt
ttaatttcaccctcagtttcaccaaaatcttggaaaggcactccagttacaaatgagaaa
aaaaaatcattatcctctatcttttcgacaatttgtatgaatcctacaatgctgataaaa
tacattcatactggagaattaaaaattccaggagattctgctgggctgtatttatgggga
aatattcttgaggaacttgatgccaaggtttctgctttatattgttatgcaattgctcta
gattggaatccagttttatggaaatcttttcaaaaactagtaggcctatcatgccagtat
cctcatgagcttgttaaaatatgttgctgcttgaataactggggcgagaagcatctagaa
tatgtgggcacaaacagcgatgctttggtaatatcaactgtgtataagaacgaagccgag
tgttggcaggtaaaaaacattcaagatgggaatcttctgatatctatatcagataagtct
gattcggaggaattatatgtattaaatgtttctgatttcttttataatgttggtgatact
ttacaaaaaagacatatgctgaggtaccattcatttactaattggttggaaaatccagtt
aaagacggcaattctggcccaaaatggccatatagtgaatttgaagatgtaaagaatgca
aatcataaatttagttcatcaaatattagtgaaattaattacaattcagttgcgaacaca
gagaatatagacgaaaacattaaacctctcgtttcacgttttcatccattgatttctatg
attcagttgctgtcaaagtttacacatcagatggaatggtatctttgccatagctttctc
aaaaatattgaaagtattccaaacaaaatttcggaaatggggtatgtaagagagttgcat
gtaagggcactttttgagtcaaatcaatggcaagagtgtataaacgtttgcaaatgtatt
aactatgaaaccaattataatctttggattaagtgtctcgatatttatagttcatgtttg
tggcagttgtccaggagcattgacttaatcaatctttcaaacttaactttaaaaattatt
gaaaagaatacccctcagctttggattgtagttggaaattgtttttccttgcataaggaa
tacgaaagttcaattaagtgctttaaaagggcaattcagtatgataaccgctatgtttat
gcttatacattgattgggcatgagctttcaattattgagaaatacgacgaagcgatccaa
atgtaccaaaaagcgttgaaaattgacccaaggtgccatagagctcactggggaatcggt
tatgtttggtttaaaagagaggaatactatcaagcaaagagccatttcaatttggcactt
aaagttgttccaaataattctacattaatacattaccttggcctttgctatctaacaact
catgattttctctctgcttataatactttccaaaagggaattctcaaagaccaaagaaat
ccttggttaaagtatcatgcaggaatcgtgttattagagctggaaagatatgaggaggct
ttaacaatgctgacagccgctcaccgcctcgcttcaaatgaacccaatattcatctatat
ctaggaaagactttctcacatttaggcaggaaggataaggcattaagacacttaaacatt
gcatttgacttaactaaagacatcaatgagaagcagatcatattgaatctgatgaaggaa
cttgaaaatggctcaaatatagagggaaggtactgcaaatcaaacgaaactaatagaagt
gggaggatttcgaatagcggcgcaggatattcatcgggtagcaaactactttcttctttt
aggaatcaccactacttccctatcaggaacgatccacctaacccgttcattcaccaccag
attcaacaagaacacaacatacctcaaactgtaccctctcctgcagtttcaggcggccat
tctttattactaacattaatgccaggaaataattga

DBGET integrated database retrieval system