KEGG   Cryptosporidium hominis: Chro.70453Help
Entry
Chro.70453        CDS       T00210                                 

Definition
protein disulfide isomerase-related protein (provisional)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cho  Cryptosporidium hominis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Chro.70453
Enzymes [BR:cho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Chro.70453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 430 aa AA seqDB search
MRNLLKLILTLSFAPLFVTCLYDSSSQVKVINGSQLKKLVKENPVVIVEFFAEWCGHCKA
FAPEYEKAAKALKGIVPVVAIDDQSDMAEYGIQGFPTVKVFTEHSVKPKDFTGPRKAESV
LNAALSALKDVTNSRLSGKTSGNKGSNKTKESSKKSRKSSVVELTDSNFDDLVIKDKENS
WFVKFYAPWCGHCKSLAPDWEELGSMADGRVKIAKLDATQHTMMAHRYKIQGFPTLLMFP
AGEKREITPVNYNGPRTANDLFEFAIKFQSSSASIKQMISQEVFENTCTKGLCVIAFLPH
IADSSDSEREKYLKIYKDVVSASAAMTIRFLWSEGGSQFDFEEKLNLAFGYPAVVAINNE
KQRFSTHRGSFTVESLNSFIIALTTGRAPVDPLPKLPKISKVSSWEPKKSKENSHAEENR
NKSNRQSDEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatcttctgaaactcatcttaacgctttcctttgctcctctatttgtgacatgc
ttatatgatagtagctcacaggtaaaagttattaatggttcacaacttaagaagttagtt
aaagaaaatcccgttgttatagtagaattttttgcagaatggtgtggacattgcaaggcg
tttgctccagaatatgaaaaagcagcaaaagctctcaaaggtatcgtgcctgttgtagct
atagatgatcagagtgatatggctgaatatggtattcaaggattcccaacagtgaaagta
ttcacagagcactccgtgaaaccaaaagatttcactggacccagaaaagctgagtctgtt
ttaaacgctgctctttcagcacttaaagatgtaacaaactcgcgtctaagtggtaaaact
tcgggtaataagggatcaaacaagactaaggaatccagtaaaaaatcaagaaagtccagc
gttgttgaacttactgatagtaactttgacgatctagtaattaaggataaggagaattct
tggttcgttaagttctatgcaccttggtgtgggcattgcaaaagccttgcccctgattgg
gaggagcttggaagtatggcagatggaagggtcaaaatcgccaagctggatgcaactcaa
cacacaatgatggctcatagatataaaattcaaggatttcccactttgttaatgttccct
gcaggagaaaagagagaaattactccagttaattataacggacccagaacagctaatgac
ctttttgaatttgcaataaaattccagtctagctctgcaagtatcaaacagatgatcagt
caggaagtttttgagaacacatgcacaaagggattgtgtgtaattgcattcctacctcac
atagcagactccagcgattctgagagagaaaaatacttgaagatatacaaggatgttgtt
tcagcctcagctgcaatgacaattcggttcctttggtcagaggggggatctcagttcgat
ttcgaagaaaagctgaaccttgcattcggatatcctgcagttgttgcaattaataacgag
aaacagagattttcaacacatagagggagcttcacagtagaatctcttaattcatttatt
attgcattgaccacgggacgcgctcccgtggatcccttacccaagctaccaaagatttct
aaagtaagttcctgggaaccaaagaaatcgaaagaaaattcacatgctgaagaaaataga
aataaatcaaatcgtcagtctgacgaactataa

DBGET integrated database retrieval system