KEGG   Cryptosporidium hominis: Chro.70453Help
Entry
Chro.70453        CDS       T00210                                 

Definition
protein disulfide isomerase-related protein (provisional)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cho  Cryptosporidium hominis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cho04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 430 aa AA seqDB search
MRNLLKLILTLSFAPLFVTCLYDSSSQVKVINGSQLKKLVKENPVVIVEFFAEWCGHCKA
FAPEYEKAAKALKGIVPVVAIDDQSDMAEYGIQGFPTVKVFTEHSVKPKDFTGPRKAESV
LNAALSALKDVTNSRLSGKTSGNKGSNKTKESSKKSRKSSVVELTDSNFDDLVIKDKENS
WFVKFYAPWCGHCKSLAPDWEELGSMADGRVKIAKLDATQHTMMAHRYKIQGFPTLLMFP
AGEKREITPVNYNGPRTANDLFEFAIKFQSSSASIKQMISQEVFENTCTKGLCVIAFLPH
IADSSDSEREKYLKIYKDVVSASAAMTIRFLWSEGGSQFDFEEKLNLAFGYPAVVAINNE
KQRFSTHRGSFTVESLNSFIIALTTGRAPVDPLPKLPKISKVSSWEPKKSKENSHAEENR
NKSNRQSDEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatcttctgaaactcatcttaacgctttcctttgctcctctatttgtgacatgc
ttatatgatagtagctcacaggtaaaagttattaatggttcacaacttaagaagttagtt
aaagaaaatcccgttgttatagtagaattttttgcagaatggtgtggacattgcaaggcg
tttgctccagaatatgaaaaagcagcaaaagctctcaaaggtatcgtgcctgttgtagct
atagatgatcagagtgatatggctgaatatggtattcaaggattcccaacagtgaaagta
ttcacagagcactccgtgaaaccaaaagatttcactggacccagaaaagctgagtctgtt
ttaaacgctgctctttcagcacttaaagatgtaacaaactcgcgtctaagtggtaaaact
tcgggtaataagggatcaaacaagactaaggaatccagtaaaaaatcaagaaagtccagc
gttgttgaacttactgatagtaactttgacgatctagtaattaaggataaggagaattct
tggttcgttaagttctatgcaccttggtgtgggcattgcaaaagccttgcccctgattgg
gaggagcttggaagtatggcagatggaagggtcaaaatcgccaagctggatgcaactcaa
cacacaatgatggctcatagatataaaattcaaggatttcccactttgttaatgttccct
gcaggagaaaagagagaaattactccagttaattataacggacccagaacagctaatgac
ctttttgaatttgcaataaaattccagtctagctctgcaagtatcaaacagatgatcagt
caggaagtttttgagaacacatgcacaaagggattgtgtgtaattgcattcctacctcac
atagcagactccagcgattctgagagagaaaaatacttgaagatatacaaggatgttgtt
tcagcctcagctgcaatgacaattcggttcctttggtcagaggggggatctcagttcgat
ttcgaagaaaagctgaaccttgcattcggatatcctgcagttgttgcaattaataacgag
aaacagagattttcaacacatagagggagcttcacagtagaatctcttaattcatttatt
attgcattgaccacgggacgcgctcccgtggatcccttacccaagctaccaaagatttct
aaagtaagttcctgggaaccaaagaaatcgaaagaaaattcacatgctgaagaaaataga
aataaatcaaatcgtcagtctgacgaactataa

DBGET integrated database retrieval system