KEGG   Cryptosporidium hominis: Chro.70471Help
Entry
Chro.70471        CDS       T00210                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cho  Cryptosporidium hominis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chro.70471
   01230 Biosynthesis of amino acids
    Chro.70471
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro.70471
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro.70471
Enzymes [BR:cho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Chro.70471
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Chro.70471
  Exosomal proteins of melanoma cells
   Chro.70471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 249 aa AA seqDB search
MTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLK
RAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDV
PPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLV
SAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDGDLKVTKKYYLISEEELKAKME
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagctaacattgattcgtcatggtgaaagtgagtggaacaaagaaaatagg
tttactggttggacagatgttagccttagtgagcaaggagtaagcgaggcaattgaggca
ggaagaatgcttttagagaaaggcttcaaattcgatgtagtttacacttcagtattaaag
agagctattatgactacatggactgtcttaaaggaactaggtaatattaattgcccaatt
attaatcactggagattaaacgaaagacattatggagctttgcaagggctcaataagtct
gaaactgcctccaagtttggagaggaccaagtcaagatttggagaagaagctttgatgtt
cctcctccagttcttgaaaagtctgatccaagatggccaggaaatgagttaatctataag
ggtatctgtccctcatgtttaccaacaacagaatgtttgaaggatactgttgaaagagtt
aagccgtactttgaggacgtaattgctccttcaatcatgtcaggcaaatctgtcctagtt
tctgctcatgggaattcccttagagctcttctctacttgctggaaggaatgacaccagaa
caaatccttgaggttaatattcccacagcatgtccacttgtattggagcttgatggtgat
ctcaaggtgacaaagaaatactatttgattagcgaggaagaactcaaggctaagatggag
gctgttgcgaatcaaggaaaagctaagtaa

DBGET integrated database retrieval system