KEGG   Cryptosporidium hominis: Chro.80094Help
Entry
Chro.80094        CDS       T00210                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Chro.80094
Protein kinases [BR:cho01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Chro.80094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 892 aa AA seqDB search
MEDDYEQNMVISHLKDREKTEEDIKTISKALAGNVVGASLNESEIATLVSSMHYYEYEVG
EVVIEQGASGFYFFVISTGSFGVEINGNRVNTMLEGTAFGELALIHNTPRSATILVIEKG
GLWGLGRSTFRDTLRLISSRNYEENRAFIESLSIFSGLTDKQKSLLSEALVREIFVKDQI
IIREKEIGNVLYMIKSGIVGVFVEDKYIRSLNEGDAFGERSLMFDEPRSATVIANATTEC
LTLNRGILTQILGNLGQVLSKNLIQQSLQNSPIFKQFTKNQMQILLDKISIKTFQKDIIL
SAAETKALNMRAFVILEGEVQVSLPSNWLSRRASSLTSMVIDKSIGSVNNYSLSDYINVN
LGRGDYFGDDFVFHPKIPFVCKIEMKSETKIGVITSSMLSECFGDENVDVGLEINRKRDA
IKSCFVFQYVSEQQLSLLVKSLRLVKFTSGEKIVVQGDKGTAFFILQSGEVAVYRNNKFI
RYLGKNDYFGERALLYDELRSATIEAATPEVHLWTVDKEAFLKIVEPPMRRYLDERIKLQ
ETRVQMSDLKILQTIGKGTFGVVYMVENIKSGNKYALKKISKSRILALNMQAHVKLERSI
LALNDHPFIIKLVRTFKDSENIYLLTELIPGGELYDALQRIGLLTRYQAQFYIGSIILAL
EYLHERSIVYRDLKPENILLDSQGYIKLIDFGCAKKIAGRSYTLAGTPHYMAPEVILGKG
YNLSCDAWAIGICLYEFLCGCLPFGNDAVDYLEIFKDILTSKLVFPRHLNDVDTVNIIKR
LLCRVPEVRMGCSATGYKEIKDNVFFKDFNFDRLLGRSYVAPLVRKYRVFAKNTENENIV
ENIAEVSQNEEALSPNTYNIKSKQKISFNASKNHSVSTRGNKMDEYDWDVEF
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgattatgaacagaatatggtaatatctcacttaaaagatagagaaaagaca
gaagaggacataaaaactatttccaaggcattggcagggaacgtagtgggagcttcactg
aatgaatctgaaattgctactttggtcagttctatgcattattacgaatatgaagtgggg
gaagtggtaattgaacaaggagcatctggattctacttttttgtcatttcaacaggaagt
tttggggttgagattaatggtaacagagtcaacacaatgttagaaggaacagcttttgga
gaattagcgcttattcacaatactccaagaagtgctaccattcttgttattgaaaaggga
ggactttggggacttggaagatccacttttagagatacactgagacttatttcatctcga
aattatgaggaaaatagagcattcattgaaagcttatcaatattttcaggtcttactgac
aaacaaaagagtctcttatctgaagctttagttagagagatttttgttaaagatcagatc
attattagagagaaagaaattggtaatgtgttatacatgattaagagtggtattgttgga
gtttttgttgaagataaatatattcgttctttaaatgagggagatgcctttggagagaga
tcgttaatgtttgacgaaccaaggtctgcaacagtaatagcaaatgcaacaactgaatgt
ttaactttgaatagaggaattcttacccagattttaggtaacttaggacaagttctgagc
aaaaacttaattcaacaatctctacagaattctccaatatttaagcaatttacgaaaaat
caaatgcaaatattacttgataagatttctattaagacttttcaaaaagacattattttg
tctgctgcagagactaaagcacttaatatgagagcctttgtcatcttagaaggagaagtg
caggtctctcttccatcaaattggctttctagaagggccagtagtttaacttctatggtt
atcgataaatctattggttctgtcaataattactcactctctgattacattaatgttaac
ttaggaagaggagattattttggggatgactttgtttttcatccaaaaattccatttgta
tgcaagattgaaatgaaaagtgaaactaaaattggagtaatcacatcttcaatgctttct
gaatgctttggggatgagaatgttgatgttggacttgaaattaacagaaaaagagatgca
attaagtcgtgttttgtcttccaatacgtttctgagcaacaactaagtcttttggtaaag
tctttaaggcttgtaaaatttactagtggtgaaaaaattgttgtacaaggtgacaaagga
actgcttttttcattttacagtctggagaagtagctgtttatagaaataacaagtttatt
cgttatcttggaaaaaatgactactttggcgaaagagctctgctttatgatgaattaaga
tctgctactattgaggctgcaacccctgaagtgcatctatggactgtagacaaagaagcc
tttcttaaaattgttgaacctccaatgcgacgatatcttgatgaaagaataaagctacag
gaaaccagagtgcaaatgagtgatttaaagattcttcaaacaattggtaaaggaacattt
ggagttgtttatatggttgaaaatattaaatcaggaaataaatatgcacttaagaaaatt
tccaagtcacgaattttggcgctcaatatgcaggcacatgtaaaattggaaaggtccatt
ttggcgctcaatgaccatccatttattattaaacttgttagaacatttaaggattcagaa
aatatatatttgttgacagagttgattcctggtggagagctatatgatgcattacaaaga
attggtttattaacacggtatcaagctcaattttatattggctcaattattctagctctc
gagtatttacatgagagatctattgtatatagagatttgaagcctgaaaatatattactg
gattctcagggatatattaaattgattgattttggttgtgcaaaaaagattgctggtaga
agttatactttggcaggtaccccacattacatggctccagaggttattcttggaaaggga
tataacttaagctgcgatgcatgggccattggaatttgcttatatgagtttttatgtggt
tgtcttccatttggaaacgatgctgttgactatttggagattttcaaggatattttaact
tcaaagttggtatttccaagacatttgaatgatgttgatactgttaatataataaagaga
ttattatgtagggttccagaggttaggatgggatgttcagctactggctataaggaaatc
aaggacaatgtattttttaaggattttaattttgataggttgttaggcaggagttatgtt
gctccactagttaggaagtatcgagtttttgcaaaaaatacagaaaatgagaatatagtt
gagaatattgctgaagttagtcagaatgaggaggctttgagtcctaatacctataatatt
aagtccaagcagaaaataagtttcaatgcttccaaaaatcactctgtaagtacaagagga
aacaagatggacgagtatgattgggatgtagaattttaa

DBGET integrated database retrieval system