KEGG   Cryptosporidium hominis: Chro.80150Help
Entry
Chro.80150        CDS       T00210                                 

Definition
clathrin, heavy polypeptide (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
cho  Cryptosporidium hominis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cho00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Chro.80150
Exosome [BR:cho04147]
 Exosomal proteins
  Proteins found in most exosomes
   Chro.80150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2006 aa AA seqDB search
MQNKGGIPITTNVLANLEELGINSSCFRFGSLTLEGDKYVGVKETSVDGGSQIVVIDTQS
KGINRKPMKAESALIHPIENILVVRGRYEDNGCTVQIFNLDSKEKLGAFLFPESVVFWRW
LTPRILAIVGDKGIYHWTIESGNSNSIPVRIFERAGKLAEQSTQIVGYQTDSGQRWCMLM
GLCPVTNESTGSISVKGQLQLFSVEKRQQQLIEGFSGNFGELIVDDFVHSPASIVCFVEK
KQEHSNARLHVMDISGQRAGSGEFGSSLSPPTPFKAVIELPTVDEGSAGGAHSFDFPIYT
YVSSYFGVIFIITRGGILYIVEPTSNTLLYCNKVCQDSVFLGSPSRFHGICMANKKGLVL
HITLNSSSVLTYIQSNPELSLNSNLLRWTQRYGYQGTDEFSIRMFNESIKRQDYQNACRV
VSLNKNGSLRTPATLNHFKMVDSSNKLLFQYFTTVFKFHTLNQFESTEFCRLLLSPNSTS
LISEFTSITQPLVFLQVLINEEKLAFSEELGDTLLQNGEKKLALKIFKKCTPQNPTKILQ
TLIEIGNFSHVSEFIREQKASNWPTITTDIRSLLNSLLIANNIDATVEFVKTVLLPPAPS
SQSDLANSISAESLDLNIDKTSVVEIFVSHSRYKEITSILLDHLKANNPEDSVLQTKLLE
VNLLHAPQVAEALFQMDLFTHYDKHAIAALCEKAGLYERALENFSDMRDIRRILGVACGS
LNTDWLANYLSKLSPRTRFDCLKELLLVCKNSSGAGGLVSMGGGLASNGALPGNGQAGLI
GNSSSNSIALSNNNTVLQSVIQVCIKNVDNIGIENIITLFEQQGIWEGIYYVVGSNLTQY
LSGNSLSSSSSAESLNLSSESLIGDSGTQNRGGAGVVLAGSGRLPSSNTGSVNGGTGSFS
TFIVFKYIEASVHLGQIQEAERICRDFPQSYEPEQVIEYFKSIKMSDLRPLIWVCDLHHR
VEELISYLYHMSLYKYIQVYTLKINPSQTPLVIGTLIDLDGSEDLVKSLLQEIKTLGSSF
SFGELIQQAENRNRLKLLLSWLEERVQEGYQDPALHNALAKIYIDMNKDSENFLKTNPHY
DAKTIGDYCEDRDPYLAYIAYRKAWGQCDDEIIQVTYKNDLYRLLARYLVERQDLDLWNK
VLGNSSNSIEPVVNEQCRQAIIDQVTSSILPEFYNKSEEISCVIRAFINAEVPNSLLEVL
EKIIFHVNNTEFSQNKNLQNLLLLTSIKIDVRRLDDYVLRLDNYDAKEVAKVAIDHGLYS
HAFQIYKKFSFNNEAVETLLMISKLELLKNEGIDIDGRGAEFMKNLDSMISIEKLANMDL
SKVQDFASYCNDNSVWDVLGQQYLKISRTKDAVDCFIKSENTRDYRLIIEHCLSVKAYRE
LLGYLQMVRRLKDSRTSKDPIVDTELAYCMSKLELLQDLQNFLQGINTVQLQKIGDRLMD
EQDYRYSIIFYQAIPNYSRLTSCYIQLGEYNNALETAKKANSPKTWKELLQICMQIGESE
LAHQAGLNIIVYPDYCEDVVSEYEKKGLTAELLTLLEGAIQNTDRANGSLFTELGILYAK
YTPEKLMDYCSSYSGRINIPKLTRICEQRQLWNEVVYLYLQYQEFDQAVLTVISHPKEAW
KNDQFLSILQNVTNVDILYKSMTFYLQEHPELLNSLLMLTLKPKKSSEMIPKSNSSDISD
YSPTKSTGGAHSQSGTGRTGSNFDLANITTRFIQQYFSQGLSSTSPNTVGPITGISPRPS
VGKESGSQSGSSYDISIIQEFLESISDENIQVVNEALINLYIEKVEVEKLMKLILTCDNY
DQAKLSARLEKHPMNDLRKLAVKILDKNSNYQQALSICQKEMLIDEAILVVYKSGNVALI
EELLEFLLSNNKKENFVACLYTCYEFLRPDTVMEMAWKHNCLDATMPFFIQSLRDMTNRI
DVLEKKLETLQITDIATTASGGHPSVSNSQNISSCVDMGPNSSISPGLISSHHVNNNSSN
NNSNSNSSNTINNNYHLMSNNKLIFH
NT seq 6021 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacaagggaggaatccctattaccaccaatgtattggcaaatttggaggaactt
ggaatcaattcatcatgttttcgatttggtagcctgacattggaaggagataaatatgtc
ggtgtaaaggaaacaagtgttgatggtggttcacagattgtcgtgattgatactcaatct
aaaggaataaatagaaagccaatgaaagcagaaagcgctttaatacatcccattgaaaat
attctagtagtcagaggaagatatgaagataatggttgtacggtccaaatctttaatcta
gactctaaagagaagcttggagcattcttatttcctgaatctgtagtattttggagatgg
ttgactccaagaattctagcaattgttggtgataagggtatatatcactggacaatagaa
tcgggaaattctaattcaattcctgttcgaatttttgagagagctggaaaattagcagaa
caatcaactcaaattgttggatatcagacagactctggccaaagatggtgtatgcttatg
ggactttgcccagtaacaaatgagtcaactgggtcaatttccgttaaaggtcagcttcag
ttattttcagtagaaaaacgacaacaacagcttattgaagggttttctggtaactttgga
gagcttattgttgatgattttgtacattctccagcatcaattgtctgctttgtcgagaag
aaacaagaacattcaaatgctagacttcatgtaatggatatttcaggccaaagagcagga
tctggtgaattcgggtcatcattatctcctccaacaccattcaaagctgttattgaactt
ccaactgtagatgaaggctcagctggaggtgcccatagctttgactttccaatatatact
tatgtttcaagttactttggagttatattcattattacaagaggtggaattctgtatatc
gtggagccaacgtcgaatactttgctttattgcaataaggtttgtcaggattctgtgttt
ttaggttctccaagccgttttcacgggatttgtatggcaaataaaaaaggactggttctc
catattactttaaatagctcatcagttcttacatatatccaatcaaatcctgaattatct
ctaaattcaaatcttcttagatggactcagagatacggttatcagggaacagatgaattc
tcaattaggatgttcaatgaatcaattaagagacaagactatcaaaatgcttgtagagtt
gtttcccttaataagaatgggagcttaagaactcctgcaactcttaatcacttcaaaatg
gttgattcttcgaataagttattattccagtactttacaactgtattcaagtttcacact
ttgaaccaatttgaaagtactgagttttgcagactattactttctccaaattctacaagt
ttaatttcagaatttacctccattacacaacctttagttttcttacaagtcctaataaat
gaagaaaagttagctttctctgaagaacttggagatacactacttcagaatggcgaaaag
aaacttgctcttaagatttttaaaaaatgtactcctcaaaatccaacgaaaattttacaa
acacttattgaaattggtaatttctcacatgtttcagaatttattcgtgaacagaaagct
tcaaactggcctactattactactgatatcaggtcattactcaacagtcttttaattgct
aacaatattgatgctactgttgagtttgttaaaacggttctactccctcctgcgccttca
tcccaatcagatctggccaattctatctctgctgaatctcttgatcttaatatagataaa
acttcagttgttgagatttttgtatcccattctagatataaggaaatcacttctatcctt
ctagaccatctcaaagctaataatccggaagattctgtcctccaaacaaaactacttgaa
gttaatctccttcatgctccacaagttgctgaagcccttttccaaatggaccttttcact
cattatgataaacatgcaattgccgccctctgcgaaaaggcgggcctttatgagcgggct
cttgagaatttctctgacatgcgtgacataaggagaatattaggagtagcttgtgggagt
ttaaataccgattggttggcaaattacttatctaaattaagtccaaggacaagatttgat
tgtttgaaggagctactattggtttgcaagaatagtagtggggcaggtggattagtttcc
atgggaggtggactagcctctaatggagcattaccgggtaatggacaagcagggttaata
ggaaacagttcatcaaattcgatagcattaagtaataataacaccgttttacagagtgtc
attcaggtatgcattaagaatgtggacaatattggaatagagaatattattactttattt
gagcaacagggaatttgggaaggcatttactatgttgtggggtccaatctgactcaatat
ttatctgggaatagcttatcttcatctagttctgctgaatctttgaatttgtctagtgaa
agcttaattggagattctggtactcaaaatagaggaggggctggagtggttctggcagga
tcaggaagattaccatcttctaatacaggatcagttaatggtggaacaggatcattttct
acctttattgtatttaagtatattgaagcttcagtccatcttggccagattcaagaggct
gagaggatttgcagggatttcccacaatcttatgaaccagaacaagtcattgagtacttt
aagagcattaagatgagtgatttaagaccattaatttgggtttgtgatcttcatcaccgt
gtagaagaattgattagttacttgtaccatatgtcactttataagtacatacaggtttat
actttgaagattaatccaagtcaaactcctttggttatcggtaccttaatagatcttgat
ggatctgaggatttagttaaatctcttttacaagagatcaagactttaggttcttcattc
tcttttggagagctaattcaacaagcagaaaacagaaatcgtctcaagttattattatct
tggcttgaagaaagagttcaagaagggtaccaagatccagctttacataatgctttggca
aagatttatattgatatgaataaggattccgagaatttcctcaagactaatcctcattat
gacgcaaaaactattggagattactgtgaagatagagatccttatcttgcatatattgct
tatagaaaggcttggggacaatgcgatgatgaaattatacaagttacctacaaaaatgat
ttatatcgtctattagctaggtaccttgttgaacgtcaagatcttgatctttggaataaa
gttttgggaaattcttcgaattctattgaacctgttgttaatgagcagtgtagacaagct
attattgatcaggttacttcttcaatattacccgagttctataataaatctgaggaaatt
agctgcgtaattagggcatttattaatgcagaggtaccgaattcattattagaagttttg
gagaagattatcttccatgttaataacactgaattttctcagaataagaaccttcaaaat
cttcttttattaacttctattaagatagatgttcgaagattggatgattacgtactcaga
ttagataattatgatgctaaggaggtggccaaagttgcaatagatcatggactttattca
catgcttttcagatctataagaagttctcttttaataatgaggctgttgagaccttatta
atgatttcaaagcttgaattgttaaagaatgagggtatcgatattgatggaaggggagct
gagtttatgaaaaacttggattctatgattagtattgaaaagttggccaatatggatcta
tctaaggttcaggattttgcatcatattgcaatgataactctgtttgggatgttcttggt
caacaatatctcaagatttctcgaacaaaggacgctgttgattgctttattaaatctgaa
aacaccagagattatagacttattattgaacattgtctttcagttaaagcttatcgagaa
ctattagggtatttacaaatggttcgaagattgaaagattctagaacatccaaagaccca
attgttgatacagaattagcttactgtatgtctaagttggagcttttgcaagatctccaa
aacttcttacaaggtattaacacagtacaacttcaaaaaattggagatagacttatggat
gaacaagattatagatactcaatcattttctatcaggcaataccaaattactcaagactt
actagttgctatattcaacttggagagtataataacgctttggaaactgctaagaaggca
aactctcctaaaacttggaaggaacttttgcagatttgtatgcagattggtgaatctgag
ttagcacatcaagctggacttaacataatagtgtatccagattactgtgaggatgtggta
tctgaatatgagaagaagggtcttacagctgagcttctaactctattggaaggagctatt
caaaacacagatcgtgctaatggtagccttttcacagaacttggaatactttatgcaaag
tatactcctgaaaagcttatggattattgttcttcttactcaggaagaattaacatccca
aagcttactaggatctgtgagcagagacagctttggaatgaggtggtatacctttacctc
caatatcaagagtttgatcaagcagttttaacagtaataagtcatccaaaagaggcatgg
aagaatgatcaattccttagtatactacaaaacgttacaaatgtggatattctctataaa
tcaatgactttctatctacaagaacatccagaattgctaaatagtttattaatgttaact
ttaaagcctaaaaaaagttcagaaatgataccaaagtcaaactctagtgatatatcagac
tattctcccactaaatcaacaggtggagctcatagtcaatcagggacaggaagaactgga
agcaattttgatcttgctaatattactactagatttattcaacagtattttagtcaagga
ctttcctcaacaagccctaatacagtgggtccaattacagggatttctccaagaccttca
gttgggaaagagagtggatcacagagtggatctagttacgatatttcaataattcaagaa
ttcttagaatccattagtgatgagaacattcaagttgtgaatgaggctttgattaattta
tacatagagaaggtggaagttgaaaagctaatgaaattaattttaacttgtgacaactat
gaccaggcaaaactttcagccagattagaaaaacatccaatgaatgatttaagaaaactt
gcagtgaagatcttagataagaactcaaattatcaacaagctctttcaatttgtcagaaa
gagatgctaatagatgaagcaatcttagtggtttacaagagtggcaatgttgctcttatt
gaagagcttttggaattcctccttagtaataacaagaaggagaactttgtagcttgttta
tatacatgctatgagtttttaagaccagatactgtaatggaaatggcttggaaacataat
tgtctggatgctacaatgccattcttcatacaaagtcttagagatatgaccaatagaatt
gatgtccttgaaaagaagcttgaaactcttcaaattactgacattgcaactacggcttct
ggcggtcatccaagtgtttcgaactcgcaaaacatttcaagttgcgttgacatggggccc
aattcttcgatttctcctggtctgatttcatctcatcatgtgaacaataacagcagtaat
aataactcaaattctaactcttccaatacaataaataataattatcatctaatgtcaaac
aataaattaatctttcactag

DBGET integrated database retrieval system