KEGG   Cryptosporidium hominis: Chro.80181Help
Entry
Chro.80181        CDS       T00210                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Chro.80181
Peptidases [BR:cho01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Chro.80181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1601 aa AA seqDB search
MHTGRNIERPSMEGFSSREKQYDYSNIPGRLQNELEFKVEGFRRRIMEMMNSTEGGTKNR
LYSNIHSYKNFNFRIMILPKVKLTSGGSLEGHISAYLEAIPSQNWPSNWVWLNTRYSVTL
INQKDYRKSHFMSDIFSFKGENDPKKKLTLEERNYDYSSAGPEADRGWSDFFSLKTLLDP
KTGFIDSETETVIFRAGVFPVLCDPVSCGKSSFDHLGTDRSLTGYVGIRNLGATCYMNSL
LQSLYHIGRFRKAVYTIPLNPNRITSGSSCSNTPISRETRPELTPMSACIPKIDDFGEVT
PQSISSESNSLAISLLGEASEDAIEWTSNVAKSLFEYESDGIASLESIMSSNACQDYGQN
TGVVSGNVSGPGSTIGGNCSASDAGNDQTKISSALQTLFYELQTCSEPVNCRELMRSFGW
DASDAFTQHDAQELNRLLCDRLEEEMKNTAVDGSIKALFEGEYENYIECLDVDCTSRRRE
NFYDIQVDVEGVKSLEESLQRFVEEEILDGENLYEAEGFGKQRAKKGVRFQRFPPVVQFH
LKRFQFNIQSMDMVKLNDYFTFPEKLDLSSFVNHNNKGETDTGNIVEGTEKYILHTVVIH
QGDVHSGHYYAYIRPKPDSDWFRFDDEKVTLVSSSTAIEDNFGGHEYEVWDYLGNPESDI
PKRSKTHSAYILVYVREDQAQDLLSEPIPQEVNPDLVSKYKKEIEMMNLRKRLRQDLNEH
VRIQLLLSTSYNISSSCRPKSQGLHQSISSFPWNYIFKCSRDFSLSQFHSELEKRFLNKR
MLHNDVPSSSVSCNKAFGSHLFLLETNPEGNHTASGGGRGMGGLHHHIGYSNGGPTSSTG
LSFYTCISSPQGEGISSGNRISDSQRGGMLGRAIGFGSSTSGTRSGDEILMSDLCRRYHR
AGLWDSSCPTLYMCLYLDDVSSLLMDRIPPNLPINADGSYLEKRQRIENKLRNFNDNGGE
EVLLLLRYFDISNPRINEPSLKYSKNQEIPNLYNLGLIMVSQSTTLKDLNEYVMMEIEKD
KDNKPSGGLISGFEFGLRVCLETALDSDNLFPLLDPRCTIQQLQLINGSSLIFSINLDDS
VINRKREELRKSLEEVVIFPNQNLWLQEEKTSQYNRIEDEGKSSESEDSSFRLPVELEMV
KCPEFPVLDFHHWYENFQNSLHLSLYLWDPLDGEYHPPHLGGGGGTHLCLPNTNQYGIME
AMQASNNSIIRSFSRYQIKEVHQIHVDLRWPAIKTWIYVCNQIKVDPRSIALARNALNPL
DASLLTLFSLIQAQRHDESISSVIRSLSSAHYYGKIPRYLAILALNLKGHSFVSLNRKDK
HILTVTNTVNCSEIPKGRYILQVESSDTVDSVIRKLIKKENILSHRSFNANGKDAMQTGN
GAKSHTDISKLKSRLFEASNQNDHVGVYRGGEMITRILNTDGMQNTSTFGGLSIGSFVDC
FRIEEDYSQEELDLLKKGELVNILVIQDSRSGFGGNYGDHYHNDDHHNSLAGGTSYLVTI
PVSSRLVDLKNKLQERFDLDEKIISKWRFYRLESKSLQGIKDNDLIMNSFGNNGVGSNNH
YTTNAKNNVDINIYGFEPHTILLAQQVFPILQKSGSRPLRI
NT seq 4806 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgggcgtaatatagagaggccgtccatggaaggcttctcgagtagagaaaaa
cagtatgactactcgaatataccaggacggcttcaaaatgagttggagtttaaggttgag
ggttttagaagaaggattatggagatgatgaacagtaccgaggggggtacgaagaaccga
ctatattcaaatattcacagttataaaaactttaattttcgaataatgattcttccaaag
gttaagttgactagtggaggttcgttagaaggtcatatttctgcgtatttggaggcaatc
ccatcgcaaaattggccttcaaactgggtatggttgaatacaagatattctgtgacctta
attaaccaaaaagattataggaaatctcactttatgagtgatatattcagctttaaagga
gaaaatgacccaaagaagaaacttacattggaggagagaaattatgactatagctctgca
ggtccagaagctgatcgtggttggagtgatttttttagcttaaagactctcttggatccg
aaaactggttttattgattctgagacagaaacagtaattttcagagctggtgtatttcca
gttttatgtgatccagtttcgtgtggaaagtcaagttttgaccatttgggtactgatcga
tcactaactggatatgttggaattcgaaaccttggagctacatgttatatgaactcctta
ctacaatctctatatcatattggaagattcagaaaagctgtctatactattcccctgaac
ccaaatagaatcacatcaggctcatcatgttctaatactccgataagtagggaaacaaga
cctgaattaactcctatgagtgcttgtattcctaagatagatgatttcggagaggttact
cctcaaagtattagttctgaatctaatagccttgccatttctttattgggagaagcctca
gaggatgctatagaatggaccagtaatgttgcaaaaagtctttttgagtatgaaagtgat
ggtattgctagtcttgaaagtattatgtcttcaaatgcatgccaagattatggacagaat
accggtgtagtaagcggtaatgtatctggcccaggatctacaataggaggaaactgctca
gcttcggatgccggaaatgatcaaacgaaaattagttctgctctccaaaccttattttac
gaacttcaaacctgttcagaacctgtgaattgtcgcgaactgatgagatcttttggctgg
gatgcttcagatgcattcacccaacatgatgcacaagagttaaatagactactttgtgac
cgtcttgaggaggaaatgaagaatactgctgttgatgggagcattaaagctctttttgaa
ggagagtatgaaaattatatcgagtgcttggatgttgattgtacttctagaaggagagaa
aacttttacgacattcaggttgatgttgaaggagtaaagtcattagaggaaagtctccag
cgttttgtagaggaagaaattttggatggtgaaaacctctatgaggctgagggctttgga
aaacagagagcaaagaagggagttagattccaaagattcccacctgttgttcagttccat
ttaaagagattccaattcaatattcaaagtatggatatggtcaagttgaatgattacttt
acttttccagaaaaattggatctatctagctttgtgaatcataataataaaggagaaaca
gatactggtaatattgtagaaggtaccgaaaagtatatattgcatactgttgtcatacat
caaggggatgttcatagtggacattattatgcctatatacgtccaaaacctgattcagac
tggtttagatttgatgatgaaaaggttactctagtttcatcttctacagctattgaggat
aattttggaggccatgagtatgaagtttgggattatttgggaaacccagaaagtgatatt
ccaaaaagatccaaaacccactcagcttacatcttggtatatgttagggaggaccaagct
caagatttgctttcggagccaattcctcaggaggtcaatcctgatttagtttctaaatac
aagaaagagattgagatgatgaatcttcgaaagagacttagacaagatctgaatgagcat
gttcgaattcaattattgttatcaactagttataatatctcatcctcttgtcgtccaaaa
tcccaaggtcttcatcaaagcatttcatcctttccatggaactacatattcaaatgttca
agggacttttctttgtctcagtttcattctgagcttgaaaagagattcttgaacaaaagg
atgcttcataatgatgttcctagtagtagtgttagttgtaataaagcttttggatctcat
ttattcctgttggaaaccaacccggaggggaaccacactgcttcaggaggaggaagagga
atgggtggattacatcatcatattggatattcaaatggaggccctacatcctcaacgggt
ctatctttttatacatgcatttcatctccccaaggagagggaattagctctggaaaccgg
atatcagattctcaaagaggtggaatgctaggtagagctattggatttggaagttcaact
tctggtacgagatcaggagatgagatcttaatgtcggatctatgtagaagataccatcgt
gcaggcctttgggactcatcttgcccaactttatatatgtgtttgtatcttgatgatgtc
tcaagtttattaatggaccgaatccctccaaatttaccaattaatgcagatggttcatat
ttagagaagaggcagaggattgaaaacaagctcagaaactttaatgataatggaggagaa
gaagttttgcttctcttgagatattttgatatttcaaaccctaggatcaatgaaccctct
ttaaaatactctaaaaatcaggagattccaaatctttataatctaggacttatcatggtt
tctcaaagcaccacacttaaggatttaaatgaatatgtaatgatggagatagagaaagat
aaagataacaaaccaagtggaggattgattagtggctttgagtttggacttagagtatgt
ctggaaacggctttagatagtgataatttattcccattattggatcctcgatgtacaatt
caacaacttcagcttatcaatggatccagtttaatcttttcaataaatttggatgattca
gtaattaatagaaagagagaagaattgaggaaatctcttgaagaggttgtgatcttccca
aatcaaaacctttggttacaagaggagaaaacttctcaatataatagaattgaagatgaa
ggaaaatcttctgaatcggaagattctagtttcaggcttccagtagaactagagatggtt
aagtgcccagaatttccagttttggactttcatcactggtatgaaaatttccagaattct
ctccatctttctctatatctatgggatcctctagatggtgaatatcacccgcctcatttg
ggaggaggaggaggaacgcatttgtgcctgcctaatacaaatcaatatggaataatggaa
gccatgcaggcgagcaataatagtataatacgctcgttttcaaggtatcaaattaaagaa
gttcatcaaattcatgtggatctccgctggccagctattaagacttggatttatgtttgt
aatcaaatcaaagtagatcctagaagtattgctttagcaagaaatgcactaaatccacta
gatgcttctttgctaactttattctctctgattcaagcccagagacatgatgaatcgata
tcttcagtaatcagaagcttaagttcagcacattattatggaaaaataccacgttattta
gctatcctggctctaaatctgaaaggtcactcctttgttagtttaaacagaaaagataaa
catattctaactgtgaccaatactgtaaattgttctgaaatacctaaaggaagatacatc
cttcaggtagaatccagtgatactgtggattcagtcatacgcaagttaataaagaaggaa
aatattttatctcacaggtcctttaatgccaatggtaaggatgccatgcaaaccggaaat
ggcgccaaaagtcacacagacatttccaagcttaaatcaagattattcgaagcgagtaac
caaaatgatcatgttggtgtatatcgaggaggggaaatgataacaaggattttaaacaca
gatggaatgcaaaatacttctacttttggaggattatctattggctcttttgtggattgc
tttaggattgaagaagattattcacaagaagagttggatttacttaaaaaaggagagtta
gtaaatattttggttattcaggattcaaggagtggttttggcgggaactatggagatcat
taccataatgatgatcatcacaattcattagctggaggtacaagttatttagtaacaata
ccagtaagttcaagattggtagatttaaagaataaactacaagaaaggtttgatttggac
gagaagataatatccaaatggagattttaccgtcttgagtcaaagagtcttcaaggaatt
aaggataatgatttaattatgaatagttttggaaataatggtgttggtagtaataatcac
tataccacaaatgcaaagaataacgtggatattaatatatatggttttgagcctcataca
attttattggctcaacaagtttttccaattctacaaaagagtggctctagacctctgaga
atttaa

DBGET integrated database retrieval system