KEGG   Cryptosporidium hominis: Chro.80199Help
Entry
Chro.80199        CDS       T00210                                 

Definition
aldehyde-alcohol dehydrogenase E
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cho  Cryptosporidium hominis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Chro.80199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro.80199
   00620 Pyruvate metabolism
    Chro.80199
   00650 Butanoate metabolism
    Chro.80199
  Lipid metabolism
   00071 Fatty acid degradation
    Chro.80199
  Amino acid metabolism
   00350 Tyrosine metabolism
    Chro.80199
Enzymes [BR:cho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Chro.80199
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Chro.80199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 822 aa AA seqDB search
MGLLEDKIIKNHFASENIYNKYRNTKTVGVIEHDEFGGIDIVAEPLGILAGISPCTNPTS
TTIFKSLISLKTRNCIVFSPHPRTARSSIRAAKIIRDAAIEAGAPEDCIGWIDVASISLC
NSLMNHSSVSAILATGSVALVKAAYSCGKPALGGGAGNSPVLVDELSDLEMVVNSVILSK
TFDNSLICASEQCLVVLDSVYDKLISGFKNRGVHIISSKDELQRLGNLLIDENGNMNPKS
VGISAVEIAKMASIDIPKDAVMILAEINEIGRGEKLSHEKLCPVLSIIRASDFNDGVSKA
KALVEFGGLGHTSCIYTDPNSDEGKRRITEFQRSIPTGRVLVCMPAAQGAMGEMFNFRQT
PSLTLGCGSWGHTSTAEGIGVKHLLNYKQVVQRRDHISWFKVPPSIYFNRGCLEEALQDL
KEINLKKAYIITDRVMVSLGFVDNLIEGLKSVGVASEMFAEVPPEPDVETVKEIVKRLNV
SKPDCLIGFGGGSPMDASKLVRLMYEHPTVKWNEVVTRFMDIRKRIVKLPPSGGKIQRFI
CIPTTSGTGAEMTPFAVITDNSTGIKYPIASYKLTPDMAIVDANFVLSMPRFLAAATGLD
ALTHALEAFVATYASEYTDGLCIQAMRLIFDHLPNSVINADAKAREYVHNASSIAGMAFS
NAFLGICHALAHQLGAQMHIPHGIANAILLPHIISYNASNRPTKQSILSQYKYPVAKSRY
AKLVDILHFKSNQSFDSNLDQESINIRILVEAIQNLKKTLQVPMCVKDHGIEEEHYMSKV
ESMSIHALDDQCVGANPRFPLLNEIKQLYIDAYSGFVRYPEH
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggattgttagaggataagataataaagaatcactttgcatctgagaatatttataat
aagtacagaaatacaaagactgtaggagtaattgaacatgatgaatttggaggaattgat
attgttgctgaaccattgggaattttggcaggaatctctccatgtacaaatccaacatct
acaacgatcttcaaatcccttatttcccttaagacaagaaactgcatagtattttctcct
catccaagaactgctagaagctccataagagcagccaaaattatcagggatgcagcaata
gaagcaggagctccagaggattgtattggttggatcgatgttgcaagtatttccttatgt
aattccttaatgaaccatagctctgtcagtgccattctagcaacaggttcagtggctttg
gtgaaggcagcttattcatgtggaaaaccagccttgggaggaggagcaggaaattcacca
gtattagttgatgaactctcagatttggaaatggttgtgaactcagtaattttatccaaa
acatttgataacagcttaatttgcgcatccgaacaatgtttggtggttctagattcagta
tatgataagttgatttctggattcaaaaatagaggagtacatatcatttcttcaaaagat
gagctccaaagacttgggaatttattaattgacgaaaatggaaatatgaatcctaaatct
gttggaattagtgcagttgagatcgcaaaaatggcatccattgatatcccaaaagatgct
gttatgattcttgctgaaatcaacgaaattggaagaggggagaaactgtctcacgaaaag
ttgtgtcctgtattgtcaatcattagagctagcgactttaatgatggtgtttccaaggca
aaagccttagttgaatttggtggtttggggcacacatcttgtatctatactgacccaaat
tctgatgaaggaaaacgcagaattactgagttccagagaagcattcccactggaagagtt
ctagtttgcatgccagctgctcaaggagcaatgggtgaaatgtttaacttccgtcaaact
ccttctttgactttgggttgtggttcctggggccatacttcaactgctgagggaattggt
gtaaaacatttgcttaattacaagcaagttgtacaaagaagagaccacatatcctggttt
aaggttccaccttctatttatttcaatagaggatgccttgaagaagctttacaagatctc
aaagaaatcaatttaaagaaagcctacattattactgacagagtcatggttagtcttggg
tttgttgataatcttattgaaggcctcaagtctgtaggagtagcttctgagatgtttgca
gaagtccctcctgagcctgatgttgaaactgtcaaggaaattgttaaaagattaaacgta
agcaaaccagattgtcttattggttttggaggaggctctcctatggacgcttccaagctt
gtaaggcttatgtatgaacatccaactgtcaaatggaatgaagttgttactagatttatg
gatattagaaagagaattgtcaagctacctcccagcggtggaaaaattcaaagatttatt
tgtattcctactacttctggaactggagcagaaatgactccatttgctgtaattaccgat
aacagcactggaatcaaatatcctattgcttcttacaagcttactcctgatatggccatt
gttgacgccaactttgttctttctatgccaaggttccttgcagctgcaacaggcttagat
gctctaacacatgcccttgaagcttttgttgcaacctatgcttctgaatacactgatgga
ctttgcattcaagctatgagacttatattcgatcatttgccaaactctgttatcaatgca
gatgccaaggcaagagaatatgtacacaacgcatcatctattgctggtatggcattctca
aatgcttttcttggaatttgccatgctctggctcaccaactgggagcccaaatgcatatt
ccacatggaattgcaaatgcaatacttctaccacatattatttcttacaatgcatctaat
agaccaacgaaacagtccattctatctcaatacaagtatcctgttgcaaagagtagatat
gcaaagcttgttgatatcttgcatttcaagtctaatcagagctttgatagtaatttggat
caagagagtattaatattagaattctagttgaagcaatacaaaatctcaagaaaacatta
caagttccaatgtgtgttaaagatcatggaatagaggaagaacattatatgtcaaaagtt
gaatctatgagtatccatgctcttgatgatcaatgtgtgggagctaatccaagattccct
cttttaaatgagattaaacaactctatattgatgcttattctggatttgtcagatatcca
gaacattaa

DBGET integrated database retrieval system