KEGG   Cryptosporidium hominis: Chro.80199Help
Entry
Chro.80199        CDS       T00210                                 

Definition
aldehyde-alcohol dehydrogenase E
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cho  Cryptosporidium hominis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cho01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cho00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cho00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cho00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cho00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cho00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 822 aa AA seqDB search
MGLLEDKIIKNHFASENIYNKYRNTKTVGVIEHDEFGGIDIVAEPLGILAGISPCTNPTS
TTIFKSLISLKTRNCIVFSPHPRTARSSIRAAKIIRDAAIEAGAPEDCIGWIDVASISLC
NSLMNHSSVSAILATGSVALVKAAYSCGKPALGGGAGNSPVLVDELSDLEMVVNSVILSK
TFDNSLICASEQCLVVLDSVYDKLISGFKNRGVHIISSKDELQRLGNLLIDENGNMNPKS
VGISAVEIAKMASIDIPKDAVMILAEINEIGRGEKLSHEKLCPVLSIIRASDFNDGVSKA
KALVEFGGLGHTSCIYTDPNSDEGKRRITEFQRSIPTGRVLVCMPAAQGAMGEMFNFRQT
PSLTLGCGSWGHTSTAEGIGVKHLLNYKQVVQRRDHISWFKVPPSIYFNRGCLEEALQDL
KEINLKKAYIITDRVMVSLGFVDNLIEGLKSVGVASEMFAEVPPEPDVETVKEIVKRLNV
SKPDCLIGFGGGSPMDASKLVRLMYEHPTVKWNEVVTRFMDIRKRIVKLPPSGGKIQRFI
CIPTTSGTGAEMTPFAVITDNSTGIKYPIASYKLTPDMAIVDANFVLSMPRFLAAATGLD
ALTHALEAFVATYASEYTDGLCIQAMRLIFDHLPNSVINADAKAREYVHNASSIAGMAFS
NAFLGICHALAHQLGAQMHIPHGIANAILLPHIISYNASNRPTKQSILSQYKYPVAKSRY
AKLVDILHFKSNQSFDSNLDQESINIRILVEAIQNLKKTLQVPMCVKDHGIEEEHYMSKV
ESMSIHALDDQCVGANPRFPLLNEIKQLYIDAYSGFVRYPEH
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggattgttagaggataagataataaagaatcactttgcatctgagaatatttataat
aagtacagaaatacaaagactgtaggagtaattgaacatgatgaatttggaggaattgat
attgttgctgaaccattgggaattttggcaggaatctctccatgtacaaatccaacatct
acaacgatcttcaaatcccttatttcccttaagacaagaaactgcatagtattttctcct
catccaagaactgctagaagctccataagagcagccaaaattatcagggatgcagcaata
gaagcaggagctccagaggattgtattggttggatcgatgttgcaagtatttccttatgt
aattccttaatgaaccatagctctgtcagtgccattctagcaacaggttcagtggctttg
gtgaaggcagcttattcatgtggaaaaccagccttgggaggaggagcaggaaattcacca
gtattagttgatgaactctcagatttggaaatggttgtgaactcagtaattttatccaaa
acatttgataacagcttaatttgcgcatccgaacaatgtttggtggttctagattcagta
tatgataagttgatttctggattcaaaaatagaggagtacatatcatttcttcaaaagat
gagctccaaagacttgggaatttattaattgacgaaaatggaaatatgaatcctaaatct
gttggaattagtgcagttgagatcgcaaaaatggcatccattgatatcccaaaagatgct
gttatgattcttgctgaaatcaacgaaattggaagaggggagaaactgtctcacgaaaag
ttgtgtcctgtattgtcaatcattagagctagcgactttaatgatggtgtttccaaggca
aaagccttagttgaatttggtggtttggggcacacatcttgtatctatactgacccaaat
tctgatgaaggaaaacgcagaattactgagttccagagaagcattcccactggaagagtt
ctagtttgcatgccagctgctcaaggagcaatgggtgaaatgtttaacttccgtcaaact
ccttctttgactttgggttgtggttcctggggccatacttcaactgctgagggaattggt
gtaaaacatttgcttaattacaagcaagttgtacaaagaagagaccacatatcctggttt
aaggttccaccttctatttatttcaatagaggatgccttgaagaagctttacaagatctc
aaagaaatcaatttaaagaaagcctacattattactgacagagtcatggttagtcttggg
tttgttgataatcttattgaaggcctcaagtctgtaggagtagcttctgagatgtttgca
gaagtccctcctgagcctgatgttgaaactgtcaaggaaattgttaaaagattaaacgta
agcaaaccagattgtcttattggttttggaggaggctctcctatggacgcttccaagctt
gtaaggcttatgtatgaacatccaactgtcaaatggaatgaagttgttactagatttatg
gatattagaaagagaattgtcaagctacctcccagcggtggaaaaattcaaagatttatt
tgtattcctactacttctggaactggagcagaaatgactccatttgctgtaattaccgat
aacagcactggaatcaaatatcctattgcttcttacaagcttactcctgatatggccatt
gttgacgccaactttgttctttctatgccaaggttccttgcagctgcaacaggcttagat
gctctaacacatgcccttgaagcttttgttgcaacctatgcttctgaatacactgatgga
ctttgcattcaagctatgagacttatattcgatcatttgccaaactctgttatcaatgca
gatgccaaggcaagagaatatgtacacaacgcatcatctattgctggtatggcattctca
aatgcttttcttggaatttgccatgctctggctcaccaactgggagcccaaatgcatatt
ccacatggaattgcaaatgcaatacttctaccacatattatttcttacaatgcatctaat
agaccaacgaaacagtccattctatctcaatacaagtatcctgttgcaaagagtagatat
gcaaagcttgttgatatcttgcatttcaagtctaatcagagctttgatagtaatttggat
caagagagtattaatattagaattctagttgaagcaatacaaaatctcaagaaaacatta
caagttccaatgtgtgttaaagatcatggaatagaggaagaacattatatgtcaaaagtt
gaatctatgagtatccatgctcttgatgatcaatgtgtgggagctaatccaagattccct
cttttaaatgagattaaacaactctatattgatgcttattctggatttgtcagatatcca
gaacattaa

DBGET integrated database retrieval system