KEGG   Cryptosporidium hominis: Chro.80372Help
Entry
Chro.80372        CDS       T00210                                 

Definition
ubiquitin carboxy-terminal hydrolase L1; gracile axonal dystrophy; protein gene product 9.5
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Chro.80372
Peptidases [BR:cho01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Chro.80372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 255 aa AA seqDB search
MNYYFYIIISAEMKNFPKFSASCEKFRFMNKKNKIWKPLISDPKLLEEYSVGLGVKSKIS
FIDIYTTEETEFYFCGINPISLIALVPINDEKICKKRNKLGCEMNISQSVWFMKQYITNS
CSAVALLHSILNNDKIELEEESIAKMLLNLKGDPNDLPRERGFYLINDKNIEYLHEKLSS
RDLTKDCDKSEFHYVSFVSNHGHIIELDGRLPCQISHGVCKSDEFLKNTLKIIKEHFILP
IGINGKIAIVALCIK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaactattatttttatattatcatttctgctgaaatgaaaaattttccaaagttttcc
gccagctgtgaaaaattcagatttatgaataaaaaaaacaaaatatggaaacctcttatt
tctgatccaaaattacttgaagagtattccgttggattaggtgttaaatctaaaattagc
tttattgatatttacacaacagaagagaccgaattttatttttgtggtataaatccaatt
tctttaatagctttagtaccaattaatgatgaaaaaatttgcaaaaagagaaataaatta
ggatgcgaaatgaatatctcccagagtgtttggttcatgaaacaatacattacgaattct
tgcagtgcagttgcgcttttacattcaattttgaataatgataaaatagaacttgaagaa
gaaagcatcgccaagatgttattgaatttaaaaggtgatccaaatgatctacccagagaa
agagggttttatttaataaatgacaagaatattgagtatctacacgaaaaattatcatca
agagatctaactaaagactgtgataaatcagagttccattatgtatcttttgtaagtaat
catgggcatataatagaattagatggaaggcttccctgtcaaattagccacggagtatgc
aaaagtgatgaatttcttaaaaacacactaaaaatcataaaagaacattttattttgcca
ataggaataaatggcaaaatagctattgttgcattgtgtataaaatag

DBGET integrated database retrieval system