KEGG   Cryptosporidium hominis: Chro.80425Help
Entry
Chro.80425        CDS       T00210                                 

Definition
acetyl-CoA carboxylase 2
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cho  Cryptosporidium hominis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cho01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cho00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cho00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:cho00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2725 aa AA seqDB search
MKKEEENLPIYSSLEEFIEINGGVNLIKKILVATSGQAAIKCIRSMRHWAYVTFGNEKAF
EFVVMATPEDIQSNSESVSEADYYVDIPMGPNYHNYANIEVIVSIAEEHECDAVWPGWGH
ASENPELPKALLRARRKIIWIGPSAESMETVGQKIQSNIIAQSVQVPCVPWSGDGISVSV
DRDGRFTGIVSDEQLQAACVNSTQECIDVCKRIGFPVMIKASSGGGGKGIRLCSSMEDLE
SNYRQVINEVKGSQVFVMRAVNKCRHLEVQVLGDKYGDVFALSTRDCTIQRRHQKVIEEG
PVTIVSQEIVKELELSAERMCKAVGYSSAGTVEFLYDIERSCIAFLEVNARLQVEHVVSE
GVANCNIPAAQLQIAMGIPLKKIRDIEEYRKLRKQGNAPPRHIIAARITSEHAEKGFTPT
CGDVFEISFRSSQTVWGYFSVASPGHIHQYSDSQFGHIFAFGMNREEARKHLIMGLKGLT
IRGEIRTNVEAVCRILENQDFITGNTYTQWLEHSVYFSSPLTKKVSMQYLNAVFAAACFT
GLRYFKESEDTFVRMLEQGQAPTSINIQYEMTLVHKGMKFICESHFIGPEHVRIMLNGSS
VTAKVRNIYPPSMQNGRDSCYLISGGFDGRNRKVFFKKDAEDNLLVTFDGTTYTFLKEQD
PRQVRAPVSGKLVRWLIQNGGQGEKGQAYVEIEIMKTYMQLTLSHSGILEHAKPQGASFN
VGDILAMLELPSEFIPPALELYPLPFPKIGGVKSPKLALETFCSGGFRGGPRMVALANFR
EGKQQLLNALNGFFPAFEDVRSALGMFYHVLDPVMPFIELQEACEVATPLIKVTVRRKIS
DLIEDVFQTFEQLSKNSWYEQFDRQLSAFISNNSCFESDVMSDQCLNSFEDNDDIEDEGQ
PPKVLQDKRLSSDGSEMPSMLLSNKADELDPKNASFAQNKKELAKEIFVNEAEQKKSFEN
SLGANIYLKNHSKNIRSASDLEIYILDCLKIVSDIIEESIQDSDNENISVDEFVAIRNQC
DPLIHIIRRNEKGRWMRLMYELHEIILKYIEIEKLFEERSSLVPARIIPSLRTEYELPEL
MQMGRSHQQLRVKNEIMEEIAKEMANNPSLLQCTAPFRDTIHQIAELTSTEYTKVAGAFR
YVLLMKENVTTTTQIQSVAKKIFEYSQLISLAQTHGQHLISIANTPSSPLQYPINATPSL
STWSGIPNLGNSQQTSLSNIIADFTNFPDFTLLACIGHPNPIIGKLAFEIYIRRHYERCG
LSFYAIKSRGEAWDSSVDISTVGNSSMLMTSCPDLKGAVPLRGEIQNFNNILGVWTHNAL
TTSSFFQNQCDPLRSNTLNIPAIQNNVDQYNQNENNSKGRTLSILESNNTSKNMSSKCHV
KGAIHIENSRWKSMLNAFSGQSLSSIADDLLEESLPIQTSIGLYFESISDFQDRFEQCVD
ELKILHGFFPQISSSVDSIVMLVILSSFSNGEITTESEVASINDENDSSSIETQSNSRDI
IEILKGTINKHQEKLSNNNIHMISFTIAPYSDQNKPESLSASLVYLKTPVHYHFRSKKGI
PIYKYNSQDLESNLSLQDSLINQAESVEIEDLENNYFIEEPFIRNIPSTLLSTLELKRLR
YFTIKSIPTSISGINLYVGTPRELCSGYSVIGKRKEAENKENNSSLKNGNSNISKSHESD
SGKNFKLSESITSEKSNYSGPQTKRISTKEMEGENLTNKSNKTLGAKPVTSKISGYNKQR
RYFIRVLVQHECSELYFEEQERYFIAALSTLESWLSFDQNYSNTSSSTVSRGHTGLNHLL
FTSVGVLNDKNSGYITTSMAEEAARTLVQRYSQRIQQSSLQTMEFRYIQRSVYQKDSNNV
VVPVRFVVDNPTGQAIRLRSFVEIKNPTTSGGKVFAAIDSKQSFLNFVSTSRSDKSFSLP
GLQQSKSLKEISNLNKGSKILTINENMVPNLALYQHEHIYDGKPLDIPHPLIGKIDQKRY
QAAELNTVYIYDFLDLFEEAIKSLWNKCPKYFVTTPSSVSLSKSNIKSARANGSTTAGIS
TNCESGFEQSSGKTAFLPNKLLEYVELDINKDSGELECVSREPGNNTCGMVAWCITMHTP
EYPKGRRVILIGNDITYQMGTFGIQEDLLFQRASEYARSLGIPRIFIAANSGARMGLATE
VQKCMKVEFVDSENPVKGYKYLYVTEEDYNKFDLQNSINYEVLDHPKDGKIYKITDVIGS
QLGLGVENLSGSGGIAGETSKASKSIMTITYATTRTVGIGAYLARLGHRVIQKAHGAPIV
LTGYQALNKVASKEIYSSNDELGGTEIMAKNGVTHLVVKDDLEGCVEILKWLSYVPECVG
GRLPIMVDPTDPIYRNITYSCNSNTEDPRLMLTGCIDSRGRWLSGLCDKDSFKEVMSDWA
KSVIVGRGRIGGIPVGFILVETRVTEYIQPADPVMPHTSELRVTRAGQIWFPDSAYKTAQ
AIRDFNMEELPLIILANWRGFSGGQKDMFDQVLKFGSYVVDELVNYKQPCFVYIPPKGEL
RGGAWVVVDSNINPEFIEMYADPTARGSVLEAAGIVEIKFRSKALKEWMMRLDPELLSLQ
EKDQLLHLKGYPIDSSERSSIKEKINKRCSLLHSVYHAAAIHFADLHDTSNRMKAKQAIH
DIVQWKNARVFFIHRIKRQLLLFSLRSEISQKLGISLTDSQNVVFQWAIQDGIDPNNNTQ
FIQWICHSANIIEQRISQLSSSDIR
NT seq 8178 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaagaggaaaaccttccaatttattcctcactagaagaatttatagaaatt
aatggaggcgttaaccttattaaaaaaattctagtggccacaagcggacaagcagcaata
aagtgtataagatctatgaggcattgggcatatgttacatttgggaatgaaaaagctttt
gaatttgtagtaatggcgacgcctgaagatatccaaagcaactcagaatctgtgagcgaa
gctgattactatgttgatatcccgatgggcccaaactatcataactatgcaaatattgaa
gtaatcgtttcaatagcagaagaacatgagtgcgatgctgtctggccaggatggggtcac
gcctctgaaaacccagagcttccaaaagctcttttaagagctagaagaaagattatttgg
attggtccttcagcagaatcaatggaaactgtagggcaaaaaatccaatcaaatattatt
gctcaatccgtacaggtcccgtgtgttccttggtcaggagatggaatttctgttagtgta
gatagggatgggcgcttcacaggtattgtttctgatgagcaacttcaagcagcgtgcgtc
aatagcactcaagaatgtattgacgtttgtaagcgaattggatttccagttatgatcaag
gctagctcgggaggtggaggaaaaggtatccgactttgcagttccatggaagacctagaa
tcaaattacagacaagttataaatgaagttaaaggtagccaagtatttgttatgcgagca
gttaataagtgtaggcatttagaggttcaagtgctaggagacaaatatggtgacgtgttc
gcattgagcacaagagattgcacaatacagaggcgtcaccaaaaggttatagaggaaggg
ccagttacaattgtgagtcaagagatcgttaaggaattggagttatctgcagagaggatg
tgcaaagctgtgggttattcatctgcaggaactgttgaatttctatatgatattgaacgt
tcatgtatagcttttctagaagttaatgccagattacaagttgaacatgttgtctctgag
ggggtagctaactgcaatatacccgcagcacagttacaaattgctatgggaattccattg
aagaaaattcgcgatattgaagaatatagaaagctaagaaagcaggggaatgcgcctcca
aggcatattatcgcagcaagaataacatctgaacatgctgagaaaggatttactccaaca
tgcggagacgtgtttgaaatatcttttagatcttcgcaaacagtatggggatacttttca
gttgcttctccaggtcatatccatcagtactccgattctcaattcggacacatttttgct
tttggaatgaatagagaagaagcaagaaaacatttaatcatgggtttgaagggcttaacc
atcagaggtgagattagaacaaatgttgaagcggtttgtagaatattagaaaatcaagat
ttcattacaggcaacacatatacacaatggctagaacatagtgtttatttctcttcaccg
ttaactaaaaaagtttcaatgcagtatttgaatgcagtatttgcagctgcatgtttcact
gggctcagatacttcaaagaaagtgaggatacatttgtgaggatgcttgagcaaggacaa
gctccaaccagtatcaatattcagtatgaaatgactctagttcacaaggggatgaagttt
atatgtgagagccactttattggtcctgaacacgtcagaattatgttgaatggtagttct
gttacagcgaaggtgcgtaatatttatccacccagtatgcaaaatgggcgtgactcgtgc
tatttaatatcaggaggttttgatggtagaaacaggaaggttttctttaaaaaagacgct
gaagataacttattggtcacatttgatggaactacttacacattcctaaaagagcaagac
cctcgtcaagttagagctccagttagtggtaagttggtaaggtggttaatacaaaatgga
ggtcaaggtgaaaagggccaggcatatgttgaaatagaaattatgaaaacatatatgcag
ctaactctttctcatagcggaattctagagcatgctaaacctcaaggcgcttcattcaat
gtaggtgatatcctagcaatgttagagctccctagtgaatttatccctcctgctttggag
ctatacccgctaccatttccaaaaataggaggggtaaaatctccaaagcttgctcttgag
actttttgctctggaggatttagaggaggcccgagaatggtagctttagcaaactttaga
gaaggaaaacaacagcttctaaatgcacttaatgggtttttcccggcctttgaggatgtt
agaagcgctcttgggatgttctaccatgttttagacccagtaatgccatttattgaactt
caagaagcttgcgaagttgccacaccacttatcaaagttacagttcgaagaaaaatatct
gatttgatagaagatgtatttcaaacatttgaacaattaagtaaaaacagctggtatgaa
cagtttgatagacaattgagcgcatttatttctaataattcttgctttgaatctgatgta
atgtcagaccaatgtttgaattcattcgaagataatgatgatatcgaagatgaaggacag
ccaccaaaagttcttcaagataaacgccttagttctgatggttctgaaatgccatcaatg
ctgctttcaaacaaagctgatgagcttgacccaaaaaatgcgagctttgcacaaaataag
aaggaattggccaaagaaatatttgtaaatgaggctgagcaaaaaaaaagttttgaaaat
tctcttggtgctaatatatatttgaagaaccattcaaaaaatattagatcggcttctgat
ttagaaatatatatattggactgcttaaagatagttagtgatattatagaagagtctata
caagattcagataatgagaatatttccgtcgacgaattcgtcgctataagaaatcagtgt
gatccattaattcatataataagaagaaatgaaaaggggagatggatgagactaatgtac
gagctgcatgaaattattctaaagtatattgaaatagaaaagttatttgaagaacgctcc
tcacttgtcccggcacgcattatcccaagccttagaacggagtatgagctccctgaacta
atgcaaatgggccgttctcaccaacaattgagagtgaagaatgaaattatggaggaaatc
gcaaaagaaatggctaacaatccatctttacttcagtgtactgctccattcagagataca
atccatcaaatagctgaattgacatcaactgagtacacaaaggtggcaggagcttttaga
tacgtattacttatgaaagagaatgttacaacaacgactcaaatacagtctgttgcaaaa
aaaatatttgagtatagtcaattaatttcattagctcagacacacggccaacatcttatt
tcgattgctaatactccttcttcacctcttcaatacccaataaatgcaactccatcatta
tctacttggagtggtattccaaatttaggaaatagccaacagacctccttgtcaaatatt
attgcagacttcactaatttccctgatttcacacttttggcatgcattggccacccaaat
ccaattattggtaagttagcttttgaaatatatatacgtcgtcattatgaaagatgcggc
ttatcattttatgctataaagagcagaggggaggcatgggatagctctgtggatattagc
accgttgggaatagcagtatgctaatgacaagctgcccagaccttaagggagcagttcca
ttaagaggagaaatccagaactttaacaatattttgggggtgtggacacataatgcttta
acaacatcatcgtttttccaaaatcaatgtgatcctttaaggtcaaatactttaaatatc
cctgcaatacaaaataatgtggatcaatataatcaaaatgaaaacaattctaaaggtaga
acactaagcatattagaatcaaataatacatcaaaaaatatgagctcaaagtgccatgta
aaaggcgcaatacatattgaaaatagccgttggaaaagcatgctaaatgcatttagtggg
caaagtttaagcagcattgcagatgacttgttggaggagtctcttcccattcaaaccagt
attgggctttattttgaatctatatctgatttccaagacagatttgaacagtgtgttgat
gaattgaaaatcttacatgggtttttcccccaaatttcttcatctgtcgattctattgtc
atgttagttatcttgtctagtttttccaatggtgagatcactactgagtcggaagtggct
tcaattaatgatgaaaatgattcctcttccattgaaactcaatcaaactcaagggacata
atagagattcttaaaggaactattaacaagcaccaagaaaaactctctaacaataacata
cacatgatttcatttacaatagctccttattccgatcaaaacaaacctgagtcactttct
gcaagcttagtttatctaaaaactcctgttcattaccatttcagatctaaaaagggaatt
ccaatttataaatacaattctcaagatctggaatctaacttatctttacaagatagccta
atcaatcaagctgaaagtgttgaaattgaggatttggagaacaactattttattgaagaa
ccatttattagaaatattcctagtactttactttctacacttgaattgaagaggctgcgt
tactttacaataaagtcaattccaacatcaatttcggggataaatttatatgttggtaca
cctagagaactgtgttccggttattctgttattggtaaacgcaaagaagccgaaaataag
gaaaacaactcttcattgaaaaatggaaactcaaatattagtaaatctcacgaatctgat
tcaggaaaaaatttcaaactttctgaatcaattacttcggaaaagtctaattattcgggc
ccccaaaccaaaaggatttcaacaaaggaaatggaaggtgaaaatctgacaaataaatct
aacaagactttaggtgcaaaaccagttacaagcaaaatttctggatataataaacagaga
agatatttcataagagtattagttcaacatgaatgcagtgagttatactttgaggaacag
gaaagatactttatagcagccttaagtactttagagtcttggctatcttttgaccaaaat
tattcgaatacaagttcaagcacagtttcaagaggtcatacaggtcttaaccatcttctt
tttacttctgttggggttttaaatgataaaaactcaggctatattacaaccagcatggca
gaagaagcagcaagaacattagttcagcgatattcacaacgaatacagcagagttcacta
caaaccatggagttccgctatattcaaaggtcagtatatcaaaaagatagtaacaacgtt
gttgtacccgttcgttttgtggtagataacccaacagggcaagcaattagattacgcagt
tttgtcgaaataaagaatcccacgaccagtggaggaaaagtgtttgcagctatagactct
aaacagtcgttcttaaacttcgtatccacaagcagatctgacaaatctttcagcctacct
gggcttcaacagtctaaaagcctaaaagaaatctctaatcttaataaagggtctaaaatt
ctaacaattaatgaaaatatggttccaaatttggctttatatcaacatgaacacatttat
gacgggaagcctctggacattcctcatcctttaattggaaaaattgatcagaaaagatat
caggctgcagagttgaatacggtttatatatatgatttcttggatctatttgaagaagca
attaagagtttgtggaataaatgcccaaaatactttgttacaacgccttctagtgtttcg
ctttctaaatcaaacataaaatcagcaagagcaaacggttctactacagcaggaatctca
actaattgtgaatcgggctttgaacaatctagtggaaagacagcatttttgcccaataaa
ctcttagagtatgttgaattggacatcaataaggattcaggagaactagaatgtgttagt
agagagcctgggaataacacctgtggaatggttgcatggtgtattactatgcatactcca
gagtacccaaagggtagaagagtgattcttataggaaatgatattacttatcaaatgggg
acctttggcattcaagaggaccttttgtttcaaagagcatcggaatacgcaagaagttta
ggaatccctagaatatttattgcagcaaatagtggtgctagaatggggctagcgacggag
gttcagaaatgcatgaaagttgaatttgttgattctgaaaacccagttaagggatacaag
tatctatatgttacggaagaagactataacaaatttgatttgcagaatagtattaattac
gaagtactagatcatcctaaagatgggaaaatatacaaaattactgatgttattggatct
cagctaggacttggagttgagaatctctcaggaagcggaggaattgcaggtgaaacatca
aaggcatctaagtcgatcatgacgattacatatgcaactactagaacagttggaattggt
gcctatttagcaaggcttggccatagagttattcaaaaagctcatggagctccaatagta
cttacaggatatcaggcactaaataaggtcgcatcaaaagaaatttatagtagcaatgat
gaattgggaggtacagagattatggcaaaaaatggtgtaacacatctcgttgttaaagat
gacttagagggttgcgtagaaatacttaaatggctgagctatgtacctgaatgcgtcgga
ggaaggctaccaataatggtggatccaacagatcctatatataggaatattacatactct
tgtaatagtaatactgaagacccaagactaatgcttactggatgcatagactcaagagga
cgttggctatctggtctttgtgataaagattctttcaaagaagttatgagtgattgggcg
aaaagcgtaatagtaggtagaggaagaattgggggaatacctgttgggttcattttagtt
gaaactagagttactgaatacattcagccagcagatccagtaatgccacacacaagtgaa
cttagagttactagagcaggacaaatatggttccctgattctgcatataagactgcacaa
gcaattcgtgatttcaatatggaagaacttccattgataattcttgcaaattggagagga
tttagtggaggccagaaagatatgttcgaccaagtcctaaagtttgggtcttacgtagtt
gatgagcttgtcaattataaacaaccttgcttcgtttacatacctccaaagggagaactg
cgcggaggagcttgggtagtagtagactcaaatattaatccagaattcattgaaatgtat
gccgaccctacagcaagaggaagcgtcttggaagctgctggaatagttgaaattaagttt
agaagcaaggcgcttaaagaatggatgatgagattagatccagaattactttccctacaa
gagaaagatcaactacttcatcttaaaggctatccaatagactcttctgaaagaagctca
ataaaagaaaagattaataaaagatgcagcttacttcattcagtttatcacgccgctgca
attcattttgcagatttgcacgatacttcaaatagaatgaaagctaagcaagcaatccat
gatattgttcagtggaagaatgcaagggtttttttcattcatcgaataaaaagacaattg
ctgcttttttctttaaggtctgaaatttcccaaaagcttggaatttctctaacagattct
caaaatgtggtctttcaatgggcaatacaagacggaatagatccaaataataacactcaa
ttcattcaatggatttgccacagtgctaacattattgaacagagaatctctcaattatct
agctctgatataaggtag

DBGET integrated database retrieval system