KEGG   Cryptosporidium hominis: Chro.80425Help
Entry
Chro.80425        CDS       T00210                                 

Definition
acetyl-CoA carboxylase 2
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cho  Cryptosporidium hominis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Chro.80425
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Chro.80425
   00640 Propanoate metabolism
    Chro.80425
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Chro.80425
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Chro.80425
Enzymes [BR:cho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Chro.80425
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Chro.80425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2725 aa AA seqDB search
MKKEEENLPIYSSLEEFIEINGGVNLIKKILVATSGQAAIKCIRSMRHWAYVTFGNEKAF
EFVVMATPEDIQSNSESVSEADYYVDIPMGPNYHNYANIEVIVSIAEEHECDAVWPGWGH
ASENPELPKALLRARRKIIWIGPSAESMETVGQKIQSNIIAQSVQVPCVPWSGDGISVSV
DRDGRFTGIVSDEQLQAACVNSTQECIDVCKRIGFPVMIKASSGGGGKGIRLCSSMEDLE
SNYRQVINEVKGSQVFVMRAVNKCRHLEVQVLGDKYGDVFALSTRDCTIQRRHQKVIEEG
PVTIVSQEIVKELELSAERMCKAVGYSSAGTVEFLYDIERSCIAFLEVNARLQVEHVVSE
GVANCNIPAAQLQIAMGIPLKKIRDIEEYRKLRKQGNAPPRHIIAARITSEHAEKGFTPT
CGDVFEISFRSSQTVWGYFSVASPGHIHQYSDSQFGHIFAFGMNREEARKHLIMGLKGLT
IRGEIRTNVEAVCRILENQDFITGNTYTQWLEHSVYFSSPLTKKVSMQYLNAVFAAACFT
GLRYFKESEDTFVRMLEQGQAPTSINIQYEMTLVHKGMKFICESHFIGPEHVRIMLNGSS
VTAKVRNIYPPSMQNGRDSCYLISGGFDGRNRKVFFKKDAEDNLLVTFDGTTYTFLKEQD
PRQVRAPVSGKLVRWLIQNGGQGEKGQAYVEIEIMKTYMQLTLSHSGILEHAKPQGASFN
VGDILAMLELPSEFIPPALELYPLPFPKIGGVKSPKLALETFCSGGFRGGPRMVALANFR
EGKQQLLNALNGFFPAFEDVRSALGMFYHVLDPVMPFIELQEACEVATPLIKVTVRRKIS
DLIEDVFQTFEQLSKNSWYEQFDRQLSAFISNNSCFESDVMSDQCLNSFEDNDDIEDEGQ
PPKVLQDKRLSSDGSEMPSMLLSNKADELDPKNASFAQNKKELAKEIFVNEAEQKKSFEN
SLGANIYLKNHSKNIRSASDLEIYILDCLKIVSDIIEESIQDSDNENISVDEFVAIRNQC
DPLIHIIRRNEKGRWMRLMYELHEIILKYIEIEKLFEERSSLVPARIIPSLRTEYELPEL
MQMGRSHQQLRVKNEIMEEIAKEMANNPSLLQCTAPFRDTIHQIAELTSTEYTKVAGAFR
YVLLMKENVTTTTQIQSVAKKIFEYSQLISLAQTHGQHLISIANTPSSPLQYPINATPSL
STWSGIPNLGNSQQTSLSNIIADFTNFPDFTLLACIGHPNPIIGKLAFEIYIRRHYERCG
LSFYAIKSRGEAWDSSVDISTVGNSSMLMTSCPDLKGAVPLRGEIQNFNNILGVWTHNAL
TTSSFFQNQCDPLRSNTLNIPAIQNNVDQYNQNENNSKGRTLSILESNNTSKNMSSKCHV
KGAIHIENSRWKSMLNAFSGQSLSSIADDLLEESLPIQTSIGLYFESISDFQDRFEQCVD
ELKILHGFFPQISSSVDSIVMLVILSSFSNGEITTESEVASINDENDSSSIETQSNSRDI
IEILKGTINKHQEKLSNNNIHMISFTIAPYSDQNKPESLSASLVYLKTPVHYHFRSKKGI
PIYKYNSQDLESNLSLQDSLINQAESVEIEDLENNYFIEEPFIRNIPSTLLSTLELKRLR
YFTIKSIPTSISGINLYVGTPRELCSGYSVIGKRKEAENKENNSSLKNGNSNISKSHESD
SGKNFKLSESITSEKSNYSGPQTKRISTKEMEGENLTNKSNKTLGAKPVTSKISGYNKQR
RYFIRVLVQHECSELYFEEQERYFIAALSTLESWLSFDQNYSNTSSSTVSRGHTGLNHLL
FTSVGVLNDKNSGYITTSMAEEAARTLVQRYSQRIQQSSLQTMEFRYIQRSVYQKDSNNV
VVPVRFVVDNPTGQAIRLRSFVEIKNPTTSGGKVFAAIDSKQSFLNFVSTSRSDKSFSLP
GLQQSKSLKEISNLNKGSKILTINENMVPNLALYQHEHIYDGKPLDIPHPLIGKIDQKRY
QAAELNTVYIYDFLDLFEEAIKSLWNKCPKYFVTTPSSVSLSKSNIKSARANGSTTAGIS
TNCESGFEQSSGKTAFLPNKLLEYVELDINKDSGELECVSREPGNNTCGMVAWCITMHTP
EYPKGRRVILIGNDITYQMGTFGIQEDLLFQRASEYARSLGIPRIFIAANSGARMGLATE
VQKCMKVEFVDSENPVKGYKYLYVTEEDYNKFDLQNSINYEVLDHPKDGKIYKITDVIGS
QLGLGVENLSGSGGIAGETSKASKSIMTITYATTRTVGIGAYLARLGHRVIQKAHGAPIV
LTGYQALNKVASKEIYSSNDELGGTEIMAKNGVTHLVVKDDLEGCVEILKWLSYVPECVG
GRLPIMVDPTDPIYRNITYSCNSNTEDPRLMLTGCIDSRGRWLSGLCDKDSFKEVMSDWA
KSVIVGRGRIGGIPVGFILVETRVTEYIQPADPVMPHTSELRVTRAGQIWFPDSAYKTAQ
AIRDFNMEELPLIILANWRGFSGGQKDMFDQVLKFGSYVVDELVNYKQPCFVYIPPKGEL
RGGAWVVVDSNINPEFIEMYADPTARGSVLEAAGIVEIKFRSKALKEWMMRLDPELLSLQ
EKDQLLHLKGYPIDSSERSSIKEKINKRCSLLHSVYHAAAIHFADLHDTSNRMKAKQAIH
DIVQWKNARVFFIHRIKRQLLLFSLRSEISQKLGISLTDSQNVVFQWAIQDGIDPNNNTQ
FIQWICHSANIIEQRISQLSSSDIR
NT seq 8178 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaagaggaaaaccttccaatttattcctcactagaagaatttatagaaatt
aatggaggcgttaaccttattaaaaaaattctagtggccacaagcggacaagcagcaata
aagtgtataagatctatgaggcattgggcatatgttacatttgggaatgaaaaagctttt
gaatttgtagtaatggcgacgcctgaagatatccaaagcaactcagaatctgtgagcgaa
gctgattactatgttgatatcccgatgggcccaaactatcataactatgcaaatattgaa
gtaatcgtttcaatagcagaagaacatgagtgcgatgctgtctggccaggatggggtcac
gcctctgaaaacccagagcttccaaaagctcttttaagagctagaagaaagattatttgg
attggtccttcagcagaatcaatggaaactgtagggcaaaaaatccaatcaaatattatt
gctcaatccgtacaggtcccgtgtgttccttggtcaggagatggaatttctgttagtgta
gatagggatgggcgcttcacaggtattgtttctgatgagcaacttcaagcagcgtgcgtc
aatagcactcaagaatgtattgacgtttgtaagcgaattggatttccagttatgatcaag
gctagctcgggaggtggaggaaaaggtatccgactttgcagttccatggaagacctagaa
tcaaattacagacaagttataaatgaagttaaaggtagccaagtatttgttatgcgagca
gttaataagtgtaggcatttagaggttcaagtgctaggagacaaatatggtgacgtgttc
gcattgagcacaagagattgcacaatacagaggcgtcaccaaaaggttatagaggaaggg
ccagttacaattgtgagtcaagagatcgttaaggaattggagttatctgcagagaggatg
tgcaaagctgtgggttattcatctgcaggaactgttgaatttctatatgatattgaacgt
tcatgtatagcttttctagaagttaatgccagattacaagttgaacatgttgtctctgag
ggggtagctaactgcaatatacccgcagcacagttacaaattgctatgggaattccattg
aagaaaattcgcgatattgaagaatatagaaagctaagaaagcaggggaatgcgcctcca
aggcatattatcgcagcaagaataacatctgaacatgctgagaaaggatttactccaaca
tgcggagacgtgtttgaaatatcttttagatcttcgcaaacagtatggggatacttttca
gttgcttctccaggtcatatccatcagtactccgattctcaattcggacacatttttgct
tttggaatgaatagagaagaagcaagaaaacatttaatcatgggtttgaagggcttaacc
atcagaggtgagattagaacaaatgttgaagcggtttgtagaatattagaaaatcaagat
ttcattacaggcaacacatatacacaatggctagaacatagtgtttatttctcttcaccg
ttaactaaaaaagtttcaatgcagtatttgaatgcagtatttgcagctgcatgtttcact
gggctcagatacttcaaagaaagtgaggatacatttgtgaggatgcttgagcaaggacaa
gctccaaccagtatcaatattcagtatgaaatgactctagttcacaaggggatgaagttt
atatgtgagagccactttattggtcctgaacacgtcagaattatgttgaatggtagttct
gttacagcgaaggtgcgtaatatttatccacccagtatgcaaaatgggcgtgactcgtgc
tatttaatatcaggaggttttgatggtagaaacaggaaggttttctttaaaaaagacgct
gaagataacttattggtcacatttgatggaactacttacacattcctaaaagagcaagac
cctcgtcaagttagagctccagttagtggtaagttggtaaggtggttaatacaaaatgga
ggtcaaggtgaaaagggccaggcatatgttgaaatagaaattatgaaaacatatatgcag
ctaactctttctcatagcggaattctagagcatgctaaacctcaaggcgcttcattcaat
gtaggtgatatcctagcaatgttagagctccctagtgaatttatccctcctgctttggag
ctatacccgctaccatttccaaaaataggaggggtaaaatctccaaagcttgctcttgag
actttttgctctggaggatttagaggaggcccgagaatggtagctttagcaaactttaga
gaaggaaaacaacagcttctaaatgcacttaatgggtttttcccggcctttgaggatgtt
agaagcgctcttgggatgttctaccatgttttagacccagtaatgccatttattgaactt
caagaagcttgcgaagttgccacaccacttatcaaagttacagttcgaagaaaaatatct
gatttgatagaagatgtatttcaaacatttgaacaattaagtaaaaacagctggtatgaa
cagtttgatagacaattgagcgcatttatttctaataattcttgctttgaatctgatgta
atgtcagaccaatgtttgaattcattcgaagataatgatgatatcgaagatgaaggacag
ccaccaaaagttcttcaagataaacgccttagttctgatggttctgaaatgccatcaatg
ctgctttcaaacaaagctgatgagcttgacccaaaaaatgcgagctttgcacaaaataag
aaggaattggccaaagaaatatttgtaaatgaggctgagcaaaaaaaaagttttgaaaat
tctcttggtgctaatatatatttgaagaaccattcaaaaaatattagatcggcttctgat
ttagaaatatatatattggactgcttaaagatagttagtgatattatagaagagtctata
caagattcagataatgagaatatttccgtcgacgaattcgtcgctataagaaatcagtgt
gatccattaattcatataataagaagaaatgaaaaggggagatggatgagactaatgtac
gagctgcatgaaattattctaaagtatattgaaatagaaaagttatttgaagaacgctcc
tcacttgtcccggcacgcattatcccaagccttagaacggagtatgagctccctgaacta
atgcaaatgggccgttctcaccaacaattgagagtgaagaatgaaattatggaggaaatc
gcaaaagaaatggctaacaatccatctttacttcagtgtactgctccattcagagataca
atccatcaaatagctgaattgacatcaactgagtacacaaaggtggcaggagcttttaga
tacgtattacttatgaaagagaatgttacaacaacgactcaaatacagtctgttgcaaaa
aaaatatttgagtatagtcaattaatttcattagctcagacacacggccaacatcttatt
tcgattgctaatactccttcttcacctcttcaatacccaataaatgcaactccatcatta
tctacttggagtggtattccaaatttaggaaatagccaacagacctccttgtcaaatatt
attgcagacttcactaatttccctgatttcacacttttggcatgcattggccacccaaat
ccaattattggtaagttagcttttgaaatatatatacgtcgtcattatgaaagatgcggc
ttatcattttatgctataaagagcagaggggaggcatgggatagctctgtggatattagc
accgttgggaatagcagtatgctaatgacaagctgcccagaccttaagggagcagttcca
ttaagaggagaaatccagaactttaacaatattttgggggtgtggacacataatgcttta
acaacatcatcgtttttccaaaatcaatgtgatcctttaaggtcaaatactttaaatatc
cctgcaatacaaaataatgtggatcaatataatcaaaatgaaaacaattctaaaggtaga
acactaagcatattagaatcaaataatacatcaaaaaatatgagctcaaagtgccatgta
aaaggcgcaatacatattgaaaatagccgttggaaaagcatgctaaatgcatttagtggg
caaagtttaagcagcattgcagatgacttgttggaggagtctcttcccattcaaaccagt
attgggctttattttgaatctatatctgatttccaagacagatttgaacagtgtgttgat
gaattgaaaatcttacatgggtttttcccccaaatttcttcatctgtcgattctattgtc
atgttagttatcttgtctagtttttccaatggtgagatcactactgagtcggaagtggct
tcaattaatgatgaaaatgattcctcttccattgaaactcaatcaaactcaagggacata
atagagattcttaaaggaactattaacaagcaccaagaaaaactctctaacaataacata
cacatgatttcatttacaatagctccttattccgatcaaaacaaacctgagtcactttct
gcaagcttagtttatctaaaaactcctgttcattaccatttcagatctaaaaagggaatt
ccaatttataaatacaattctcaagatctggaatctaacttatctttacaagatagccta
atcaatcaagctgaaagtgttgaaattgaggatttggagaacaactattttattgaagaa
ccatttattagaaatattcctagtactttactttctacacttgaattgaagaggctgcgt
tactttacaataaagtcaattccaacatcaatttcggggataaatttatatgttggtaca
cctagagaactgtgttccggttattctgttattggtaaacgcaaagaagccgaaaataag
gaaaacaactcttcattgaaaaatggaaactcaaatattagtaaatctcacgaatctgat
tcaggaaaaaatttcaaactttctgaatcaattacttcggaaaagtctaattattcgggc
ccccaaaccaaaaggatttcaacaaaggaaatggaaggtgaaaatctgacaaataaatct
aacaagactttaggtgcaaaaccagttacaagcaaaatttctggatataataaacagaga
agatatttcataagagtattagttcaacatgaatgcagtgagttatactttgaggaacag
gaaagatactttatagcagccttaagtactttagagtcttggctatcttttgaccaaaat
tattcgaatacaagttcaagcacagtttcaagaggtcatacaggtcttaaccatcttctt
tttacttctgttggggttttaaatgataaaaactcaggctatattacaaccagcatggca
gaagaagcagcaagaacattagttcagcgatattcacaacgaatacagcagagttcacta
caaaccatggagttccgctatattcaaaggtcagtatatcaaaaagatagtaacaacgtt
gttgtacccgttcgttttgtggtagataacccaacagggcaagcaattagattacgcagt
tttgtcgaaataaagaatcccacgaccagtggaggaaaagtgtttgcagctatagactct
aaacagtcgttcttaaacttcgtatccacaagcagatctgacaaatctttcagcctacct
gggcttcaacagtctaaaagcctaaaagaaatctctaatcttaataaagggtctaaaatt
ctaacaattaatgaaaatatggttccaaatttggctttatatcaacatgaacacatttat
gacgggaagcctctggacattcctcatcctttaattggaaaaattgatcagaaaagatat
caggctgcagagttgaatacggtttatatatatgatttcttggatctatttgaagaagca
attaagagtttgtggaataaatgcccaaaatactttgttacaacgccttctagtgtttcg
ctttctaaatcaaacataaaatcagcaagagcaaacggttctactacagcaggaatctca
actaattgtgaatcgggctttgaacaatctagtggaaagacagcatttttgcccaataaa
ctcttagagtatgttgaattggacatcaataaggattcaggagaactagaatgtgttagt
agagagcctgggaataacacctgtggaatggttgcatggtgtattactatgcatactcca
gagtacccaaagggtagaagagtgattcttataggaaatgatattacttatcaaatgggg
acctttggcattcaagaggaccttttgtttcaaagagcatcggaatacgcaagaagttta
ggaatccctagaatatttattgcagcaaatagtggtgctagaatggggctagcgacggag
gttcagaaatgcatgaaagttgaatttgttgattctgaaaacccagttaagggatacaag
tatctatatgttacggaagaagactataacaaatttgatttgcagaatagtattaattac
gaagtactagatcatcctaaagatgggaaaatatacaaaattactgatgttattggatct
cagctaggacttggagttgagaatctctcaggaagcggaggaattgcaggtgaaacatca
aaggcatctaagtcgatcatgacgattacatatgcaactactagaacagttggaattggt
gcctatttagcaaggcttggccatagagttattcaaaaagctcatggagctccaatagta
cttacaggatatcaggcactaaataaggtcgcatcaaaagaaatttatagtagcaatgat
gaattgggaggtacagagattatggcaaaaaatggtgtaacacatctcgttgttaaagat
gacttagagggttgcgtagaaatacttaaatggctgagctatgtacctgaatgcgtcgga
ggaaggctaccaataatggtggatccaacagatcctatatataggaatattacatactct
tgtaatagtaatactgaagacccaagactaatgcttactggatgcatagactcaagagga
cgttggctatctggtctttgtgataaagattctttcaaagaagttatgagtgattgggcg
aaaagcgtaatagtaggtagaggaagaattgggggaatacctgttgggttcattttagtt
gaaactagagttactgaatacattcagccagcagatccagtaatgccacacacaagtgaa
cttagagttactagagcaggacaaatatggttccctgattctgcatataagactgcacaa
gcaattcgtgatttcaatatggaagaacttccattgataattcttgcaaattggagagga
tttagtggaggccagaaagatatgttcgaccaagtcctaaagtttgggtcttacgtagtt
gatgagcttgtcaattataaacaaccttgcttcgtttacatacctccaaagggagaactg
cgcggaggagcttgggtagtagtagactcaaatattaatccagaattcattgaaatgtat
gccgaccctacagcaagaggaagcgtcttggaagctgctggaatagttgaaattaagttt
agaagcaaggcgcttaaagaatggatgatgagattagatccagaattactttccctacaa
gagaaagatcaactacttcatcttaaaggctatccaatagactcttctgaaagaagctca
ataaaagaaaagattaataaaagatgcagcttacttcattcagtttatcacgccgctgca
attcattttgcagatttgcacgatacttcaaatagaatgaaagctaagcaagcaatccat
gatattgttcagtggaagaatgcaagggtttttttcattcatcgaataaaaagacaattg
ctgcttttttctttaaggtctgaaatttcccaaaagcttggaatttctctaacagattct
caaaatgtggtctttcaatgggcaatacaagacggaatagatccaaataataacactcaa
ttcattcaatggatttgccacagtgctaacattattgaacagagaatctctcaattatct
agctctgatataaggtag

DBGET integrated database retrieval system