KEGG   Cryptosporidium hominis: Chro.80498Help
Entry
Chro.80498        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Chro.80498
Peptidases [BR:cho01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Chro.80498
Transcription machinery [BR:cho03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Chro.80498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 671 aa AA seqDB search
MASILGQEAEKRQDSHPVTLQLSNRLVNFVSGGFLANKTGIESPSYVSDNSQISDKTQKH
MDKLKEKEQIENNVPLAKPEYYYFPPELLTDARDFLEPKEISQFRPYGRGLANPGWNTCY
FNSILQALTYAPYLSIDCLRRNHQKICKHMKEHLVCIMCMFEDHVNIMLDNTSKSNIKND
QPVVSSFIKCAQKLIWKRFRIGMMHDAQEFLRYFLEALHKSCLPKNLQTDQTFRKIHPIA
ASTTYIGQLFCGFFLSRIVCHNCQYTSNTYDPFMDVPLDIMGVSNLENALKLFTKIEYLK
GENRYMCPKCNQRSDASKQLLIEKLPPLLTIQLKRFSYVGHGSRKPNKAINFSDVLDLQP
YISSKTYSESSYIYKLWAVVCHSGNTLSCGHYYTHAKSIDNKWYCFNDDYVKPTRIENVL
NENHKAYLLFYYRSDFNKYDLLKDSGVSIESLEKSQIITPLAPEISFINLQLKSNSKSSV
NGKNNNSKESSNSEPNLNEFLDQLLTNKSKGERDLAQNQDQDQYQDPNLQFYQNQQNNNN
IRLVLNPIINTDVNNEKLDSKISIISKNKQTEKIIKAKICNFKLRSLLLCDNWITRSKSR
RNLATIFYLKKLKKLGLSMSYFIKSKSGNCLNGKVLISNINKSQIDTWEDLNLSNDTITS
LEQAQKSLLAR
NT seq 2014 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattttaggtcaagaagctgagaagcggcaagattctcatcctgtgaccctt
caattgtcaaatcgtctagtcaatttcgtttctggaggatttttggcaaacaaaacaggt
atagagtctccttcttacgtttcagataattcccagatctcagataaaacacaaaaacac
atggacaaattaaaagaaaaagaacaaattgaaaataacgttccattagcaaaaccagaa
tattattatttccctccagaattactcactgatgcaagagattttcttgaaccaaaagaa
atctctcagttcagaccatatggtagaggattagctaatcctggttggaatacatgttat
tttaattctattttacaagcattaacttatgcaccttatctttcaattgattgcttaagg
aggaatcaccaaaagatttgtaaacatatgaaagaacatttggtttgtattatgtgtatg
tttgaagatcatgttaatattatgttggataatacatccaaatctaatataaaaaatgac
caaccagtagtttctagttttatcaaatgtgctcaaaaactaatatggaaaagatttaga
attggaatgatgcatgatgcacaagaatttctaaggtatttcttagaagctttacataaa
tcttgtttacctaagaatttacaaactgatcaaacttttaggaaaatacatcctattgca
gcttctacaacttatattggtcaactattttgtggattctttctttctaggattgtatgt
cataattgtcaatatacttccaatacatatgacccatttatggatgtaccacttgatatt
atgggggtatcgaatttagaaaatgctctcaaattatttactaaaattgaatatcttaaa
ggtgaaaatagatatatgtgtccaaaatgtaatcagagatctgatgcttcaaaacaactt
ctaattgagaaacttcctccactgttaacaattcaacttaagagatttagttatgtaggg
catggaagtagaaaacctaacaaagctatcaatttttcagatgttttagacttacaacca
tatatatcttctaagacttactctgaatcctcttatatttacaaattatgggctgtagta
tgccattctggtaatactttatcttgcggtcattattatacccatgctaagagtatcgac
aacaaatggtattgctttaatgatgattacgttaaaccaacaagaatagaaaatgtatta
aatgagaatcataaggcttatttgttgttttactataggagtgattttaataaatatgac
ttacttaaggattctggtgtctccatagagtccttagagaaatctcagatcattactcct
ttagctcctgaaatatcatttataaatcttcaacttaaatcaaactcaaaatcttctgta
aatggtaaaaataataattctaaagaatcatcaaattctgaaccaaatttgaatgaattt
ttggatcaattattaacaaataagtctaaaggagaaagagatttagcccaaaatcaagat
caagatcaatatcaagatccaaacttacaattttatcaaaatcaacaaaataataacaat
attagactagttttgaatccaataataaatacggatgtaaataatgagaaattagattca
aagatttctataatatctaaaaataaacaaacagaaaagattattaaggctaagatttgt
aatttcaagcttagatccttattactatgcgataattggattactagatccaaatcaaga
aggaatttggcaaccattttttatcttaagaaattaaagaaacttggattatcaatgagc
tactttattaaatcaaaatcaggaaattgtttaaatggaaaagttttgattagtaatatt
aacaagagtcaaatagacacttgggaagatcttaatttatccaatgatactattacaagc
ttggaacaagctcaaaaatctcttcttgctcgtt

DBGET integrated database retrieval system