KEGG   Cryptosporidium hominis: Chro.80536Help
Entry
Chro.80536        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cho  Cryptosporidium hominis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Chro.80536
   00240 Pyrimidine metabolism
    Chro.80536
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Chro.80536
   03410 Base excision repair
    Chro.80536
   03420 Nucleotide excision repair
    Chro.80536
   03430 Mismatch repair
    Chro.80536
   03440 Homologous recombination
    Chro.80536
DNA repair and recombination proteins [BR:cho03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      Chro.80536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 128 aa AA seqDB search
MPPNVNKKRKRPTKGLKESEKENQSKLVGFKTSIVRPIVNPELEATDLKPVKSANDNEQL
LNTLHSFDLDHTFGPCSEISRSKRLERAKKFGIALDLNLEKMINKHCGDVNSEMSVSIID
KLMKHYSD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaatgtaaataagaagagaaaaaggccaactaaaggcttaaaagaaagtgaa
aaggaaaatcaatcaaaactagtaggattcaagactagtattgttagaccaatagtaaat
ccagaattggaagctacagatttaaaaccagtaaagagtgctaatgataatgaacaactt
ttaaatacattgcatagttttgacttggaccacacttttggtccatgcagtgaaatttcc
agatctaaaagacttgaaagagctaaaaaatttggaatagctttagacttgaatttagaa
aagatgataaataaacactgtggagatgttaatagtgagatgtcagtttcaataatagat
aaattaatgaaacattattccgattag

DBGET integrated database retrieval system