KEGG   Chlamydia psittaci 6BC: CPSIT_0134Help
Entry
CPSIT_0134        CDS       T01481                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
chp  Chlamydia psittaci 6BC
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:chp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124642..125265
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGVLTYISSGTMVVESQGLGFSIFAPDRWLMELSSQLHRELIVYTYTVVRETEHV
LYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDIKAIASVPGIGKK
TAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAALGYPKSSAERMIAEAM
SELPDHASIAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggtgtgcttacttatatcagttcaggaactatggtagttgaa
agtcagggactggggtttagtatttttgctcctgatagatggcttatggaattgtcaagt
caactacaccgcgagcttatagtctatacttatactgttgttcgtgaaactgagcatgtt
ctctatggatttaatactcgtggagaacgcgagtgtttccgtatgttaatttcattttca
ggagtgggacctaagacaggtttagcgattttaaatacattttctcttagcaaattgtgt
tctatagctcgtgctgaggatatcaaagctatagcttctgttccgggtatagggaagaaa
acagctgagaaacttatggtggatttgaagcaaaagcttgcagacttactccctttagat
tcgcaaatcaccgcttcttggggaccagcaaaaccttcttgtatggaagagggaatacaa
gctttagcagcattaggctatccaaaatcctcagcagagagaatgatcgccgaagctatg
agcgagctcccggatcatgcgtcaatagcagaaattcttcctattgctctaaagaagaat
ttacaaggtttgaacaagagctag

DBGET integrated database retrieval system