KEGG   Chlamydia psittaci 6BC: CPSIT_0249Help
Entry
CPSIT_0249        CDS       T01481                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
chp  Chlamydia psittaci 6BC
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240180..240845)
Genome map
AA seq 221 aa AA seqDB search
MTIYLGLNRETANRYHASFVPILEIIPFARSSPQLRYALRYLEETSHILLTSPSSTSLFI
SRMRRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSLATIETGEGVLPMISSLPKNAR
ILYPHSALSRPVIEDFLKRENRSFFAYSHYTIRERQLHPSVFKQCSRVILTSPSGVRAYA
KLFPQLPRRIHICQGPITLKEFREIYNHPGELLQKDSLTES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcgagaaacagcaaacagataccacgccagcttcgtt
ccgattcttgagatcattccctttgcaagaagctctcctcaactacgttacgccctgcgt
tacctagaagaaacttctcatatcctgctcaccagcccatcttcaacatcactatttatt
tctagaatgcgcagaaaaaattctaaaaagacgttatctaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccctagct
actattgaaaccggagaaggcgtgctcccaatgatctcctctttacccaaaaacgctcgt
atcctctacccacactcagccttatcgcgtcctgtaattgaagattttttaaaaagagaa
aaccgaagcttttttgcctattcccactacaccattcgagaacgtcaattacacccctct
gtattcaagcagtgcagccgtgtaattttaaccagtccctctggagttagggcgtatgct
aaactcttcccccagctcccaaggagaatacacatctgccaaggcccgatcacacttaaa
gaatttagggaaatttacaaccatcctggggaacttcttcaaaaggacagccttaccgaa
agctga

DBGET integrated database retrieval system