KEGG   Chlamydia psittaci 6BC: CPSIT_0249Help
Entry
CPSIT_0249        CDS       T01481                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
chp  Chlamydia psittaci 6BC
Pathway
chp00860  Porphyrin and chlorophyll metabolism
chp01100  Metabolic pathways
chp01110  Biosynthesis of secondary metabolites
chp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPSIT_0249 (hemD)
Enzymes [BR:chp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CPSIT_0249 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ErmC
Motif
Other DBs
NCBI-ProteinID: ADZ18312
Position
complement(240180..240845)
Genome map
AA seq 221 aa AA seqDB search
MTIYLGLNRETANRYHASFVPILEIIPFARSSPQLRYALRYLEETSHILLTSPSSTSLFI
SRMRRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSLATIETGEGVLPMISSLPKNAR
ILYPHSALSRPVIEDFLKRENRSFFAYSHYTIRERQLHPSVFKQCSRVILTSPSGVRAYA
KLFPQLPRRIHICQGPITLKEFREIYNHPGELLQKDSLTES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcgagaaacagcaaacagataccacgccagcttcgtt
ccgattcttgagatcattccctttgcaagaagctctcctcaactacgttacgccctgcgt
tacctagaagaaacttctcatatcctgctcaccagcccatcttcaacatcactatttatt
tctagaatgcgcagaaaaaattctaaaaagacgttatctaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccctagct
actattgaaaccggagaaggcgtgctcccaatgatctcctctttacccaaaaacgctcgt
atcctctacccacactcagccttatcgcgtcctgtaattgaagattttttaaaaagagaa
aaccgaagcttttttgcctattcccactacaccattcgagaacgtcaattacacccctct
gtattcaagcagtgcagccgtgtaattttaaccagtccctctggagttagggcgtatgct
aaactcttcccccagctcccaaggagaatacacatctgccaaggcccgatcacacttaaa
gaatttagggaaatttacaaccatcctggggaacttcttcaaaaggacagccttaccgaa
agctga

DBGET integrated database retrieval system