KEGG   Chlamydia psittaci 6BC: CPSIT_0339Help
Entry
CPSIT_0339        CDS       T01481                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chp  Chlamydia psittaci 6BC
Pathway
chp00010  Glycolysis / Gluconeogenesis
chp00051  Fructose and mannose metabolism
chp01100  Metabolic pathways
chp01110  Biosynthesis of secondary metabolites
chp01120  Microbial metabolism in diverse environments
chp01130  Biosynthesis of antibiotics
chp01200  Carbon metabolism
chp01230  Biosynthesis of amino acids
Module
chp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPSIT_0339 (tpiA)
   00051 Fructose and mannose metabolism
    CPSIT_0339 (tpiA)
   00562 Inositol phosphate metabolism
    CPSIT_0339 (tpiA)
Enzymes [BR:chp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPSIT_0339 (tpiA)
Exosome [BR:chp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPSIT_0339 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPSIT_0339 (tpiA)
  Exosomal proteins of melanoma cells
   CPSIT_0339 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ18208
Position
361307..362071
Genome map
AA seq 254 aa AA seqDB search
MERKRYIFGNWKMHKTAKEAKDYLSVFCPLLEEVAPVSRVGITPAFTALHACCESIKSFH
SPLWLGAQNVHQDASGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAA
AREGIIPVLCIGETLEVREKGATEAMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVA
SAVDVQEAHAFCREVLANIFSKEKAEEISILYGGSVKADNAEGFARCPDVDGLLVGGASL
DPKVFADVVANFHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagcgttatattttcggtaattggaaaatgcataagacagctaaagaggct
aaagattatttgtctgttttctgccctctccttgaagaagttgctcctgtatctcgtgtg
ggtatcacccccgcattcacagcgttacatgcttgctgtgaatctataaagtcttttcac
agtcctctgtggctgggagcgcaaaatgtccatcaggatgcctcgggagcctttacaggt
gaaatttccttgcctatgctcaaagaatttgatgtcaattttgtacttttaggtcactcc
gaatgccgtcatatttttcatgaagaagatacgaccattgcgcttaaggttggtgccgca
gctcgtgaaggcattattcccgttctgtgtatcggagaaactctagaagttagagaaaaa
ggcgcgacggaagctatgttatctaaccagttgatgttggggcttgcgcaacttccggaa
actgcctctgtaatcattgcttatgaacccgtatgggcaattggtacgggtaaagtagct
tcagcggttgatgtgcaagaggcacatgccttttgtcgagaggtgcttgcgaatatattt
tccaaagagaaagctgaggagatttccattctttatgggggatctgtaaaggcagataat
gctgaaggatttgctcgttgtcctgatgtagacgggttgttagtaggaggcgcttcctta
gatcctaaagtttttgccgatgttgtcgcgaattttcatcgttag

DBGET integrated database retrieval system