KEGG   Chlamydia psittaci 6BC: CPSIT_0339Help
Entry
CPSIT_0339        CDS       T01481                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chp  Chlamydia psittaci 6BC
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPSIT_0339 (tpiA)
   01230 Biosynthesis of amino acids
    CPSIT_0339 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPSIT_0339 (tpiA)
   00051 Fructose and mannose metabolism
    CPSIT_0339 (tpiA)
   00562 Inositol phosphate metabolism
    CPSIT_0339 (tpiA)
Enzymes [BR:chp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPSIT_0339 (tpiA)
Exosome [BR:chp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPSIT_0339 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPSIT_0339 (tpiA)
  Exosomal proteins of melanoma cells
   CPSIT_0339 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361307..362071
Genome map
AA seq 254 aa AA seqDB search
MERKRYIFGNWKMHKTAKEAKDYLSVFCPLLEEVAPVSRVGITPAFTALHACCESIKSFH
SPLWLGAQNVHQDASGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAA
AREGIIPVLCIGETLEVREKGATEAMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVA
SAVDVQEAHAFCREVLANIFSKEKAEEISILYGGSVKADNAEGFARCPDVDGLLVGGASL
DPKVFADVVANFHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagcgttatattttcggtaattggaaaatgcataagacagctaaagaggct
aaagattatttgtctgttttctgccctctccttgaagaagttgctcctgtatctcgtgtg
ggtatcacccccgcattcacagcgttacatgcttgctgtgaatctataaagtcttttcac
agtcctctgtggctgggagcgcaaaatgtccatcaggatgcctcgggagcctttacaggt
gaaatttccttgcctatgctcaaagaatttgatgtcaattttgtacttttaggtcactcc
gaatgccgtcatatttttcatgaagaagatacgaccattgcgcttaaggttggtgccgca
gctcgtgaaggcattattcccgttctgtgtatcggagaaactctagaagttagagaaaaa
ggcgcgacggaagctatgttatctaaccagttgatgttggggcttgcgcaacttccggaa
actgcctctgtaatcattgcttatgaacccgtatgggcaattggtacgggtaaagtagct
tcagcggttgatgtgcaagaggcacatgccttttgtcgagaggtgcttgcgaatatattt
tccaaagagaaagctgaggagatttccattctttatgggggatctgtaaaggcagataat
gctgaaggatttgctcgttgtcctgatgtagacgggttgttagtaggaggcgcttcctta
gatcctaaagtttttgccgatgttgtcgcgaattttcatcgttag

DBGET integrated database retrieval system