KEGG   Chlamydia psittaci 6BC: CPSIT_0647Help
Entry
CPSIT_0647        CDS       T01481                                 

Definition
(RefSeq) diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chp  Chlamydia psittaci 6BC
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPSIT_0647
   01230 Biosynthesis of amino acids
    CPSIT_0647
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPSIT_0647
   00030 Pentose phosphate pathway
    CPSIT_0647
   00051 Fructose and mannose metabolism
    CPSIT_0647
   00052 Galactose metabolism
    CPSIT_0647
  Energy metabolism
   00680 Methane metabolism
    CPSIT_0647
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPSIT_0647
Enzymes [BR:chp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPSIT_0647
Protein phosphatases and associated proteins [BR:chp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPSIT_0647
Messenger RNA biogenesis [BR:chp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPSIT_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
683332..684990
Genome map
AA seq 552 aa AA seqDB search
MHVNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTLDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TVEITEEFMESFKNSGGFNCIGTGRTNIITEENKARCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEDADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFIKFKLYRKIWALEDSYRFLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaactccaatgatctcaacgacgtagttatcccaggtactcctcccctcccg
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgctaagcttttcccgaatacctatgacagtccttacctaaaattt
acttcaggaactcttgaccaacctgttcgtccattaaaagtaggtgtgatgctatcggga
ggtcctgctcccggaggtcataatgttatttggggattacttcatagcttaaagaaaata
catcccgacagctcgctcattggctttcttaataacggccaagggattctcaataatcat
acagtagaaattaccgaagaattcatggagtctttcaaaaattccggaggattcaactgt
ataggcacaggaagaacaaacatcatcactgaagaaaataaagcccgatgcttaaaaaca
gtacaagctttagaccttgatggtttagtaattattggcggtgatggttcgaatacagca
acggctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgtc
ccaaaaactattgatggagatcttcaacatctatttttagaccttacctttggatttgat
tcagcaacaaaattttattcctccattattagcaacatttctagagatacgctatcttgc
aaagcgcattaccacgtgatcaagcttatgggacgctctgcatcgcacattgctttagaa
tgcactctacaaacccatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gtgcctctaaatacgataatccataaagtctgttcgatcattgctgatagagccgctatg
gggaaatactatgggattattcttattcctgaaggcattatcgaattcatccctgagatt
aacaaccttgttaaagaaatcgaaagaatccctgaagatgcggataaattttcttctcta
tcccgtgaatctcaaaaattactaaaaagcttcccagaaactatcgctaaacaactcctt
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccaccttgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcgtgcctacccacaaaattcgataatacctac
agctacgccctaggatatggcgcaggagttcttacgtataaccgctgcaacggctacctc
actgtcatcgaatcactgattaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaagaag
agtttaattgatattagcagtcctgcttttattaagtttaaactctatagaaaaatatgg
gctctagaagattcttatcgttttttaggaccattacaaattgacaccccgcccaactct
cattccgatcatttccctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaattcctgactgcgattattaa

DBGET integrated database retrieval system