KEGG   Chlamydia psittaci 6BC: CPSIT_0695Help
Entry
CPSIT_0695        CDS       T01481                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
chp  Chlamydia psittaci 6BC
Pathway
chp00230  Purine metabolism
chp01100  Metabolic pathways
Module
chp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPSIT_0695 (gmk)
Enzymes [BR:chp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPSIT_0695 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin AAA_16 Cytidylate_kin AAA_22 dNK AAA_17 AAA_33 AAA AAA_23 Cytidylate_kin2 ABC_tran AAA_30 TsaE Zeta_toxin cobW RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ADZ18652
Position
complement(743834..744448)
Genome map
AA seq 204 aa AA seqDB search
MKDKVRVPFSPDHPLCVPKLFTISAPAGAGKTTLVRMLAQEFPDSFQKTLSLTTRAPRPE
EVPGVDYQFVSQEEFQRRLDNDDFLEWVALFGEYYGTSRLGIDEIWKSGRHAVAVIDVEG
ALVLRSKIPTVTIFISAPSQEELERRLKQRGSEQDTQRQERLQHSLIEQAAANKFEYVII
NDDLEKSYEVLKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagttcgtgttcctttttctcccgatcatcccctatgcgtaccaaaatta
tttactattagtgctcctgctggagctgggaaaacaacgctagtacgtatgttggctcaa
gaatttccagattcttttcagaagactttatcacttacaacacgagcacctcgtcctgaa
gaagttcctggagtagattatcagtttgtttctcaagaggagtttcaacgacgcttagac
aatgatgattttcttgagtgggtagcactttttggagagtattacggaacgagtcgttta
gggattgatgaaatttggaaatctgggagacacgcggttgcggttattgacgtggaagga
gctttggtcttgcggagtaaaattcccacagtgacgatttttatttctgcgccatctcag
gaagagctagaaaggcgtctaaaacaaagaggatcagaacaagatactcaaagacaagag
cggttgcagcatagtcttattgaacaagctgcggctaataaatttgaatacgtcattatc
aatgatgatttggagaaatcttacgaggttttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system