KEGG   Chlamydia psittaci 6BC: CPSIT_0833Help
Entry
CPSIT_0833        CDS       T01481                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
chp  Chlamydia psittaci 6BC
Pathway
chp00020  Citrate cycle (TCA cycle)
chp00640  Propanoate metabolism
chp01100  Metabolic pathways
chp01110  Biosynthesis of secondary metabolites
chp01120  Microbial metabolism in diverse environments
chp01130  Biosynthesis of antibiotics
chp01200  Carbon metabolism
Module
chp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPSIT_0833
   00640 Propanoate metabolism
    CPSIT_0833
   00660 C5-Branched dibasic acid metabolism
    CPSIT_0833
Enzymes [BR:chp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPSIT_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADZ18901
Position
complement(897826..898986)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYNIAIPPYRVASSVEEGRHTLNELGISAGVVKVQVHAGGRGKNGGV
IVAKSPDEILAAVDKLLRMRFTSNQTSGEALPVEKVLITPLVNIATEYYLAVIMDRKNRC
PAIMLSRAGGVDIEEVAQKYPDQLLTIPLTPFARIYNYQLRQMIKFMGWEGDTGKQGVQL
IKSLVQCFYDNDASLLEINPLVLTQEGDLLVLDAKVTIDDNALYRHPKLEVLYDPSQENV
RDVLAKQIGLSYIALDGNIGCLVNGAGLAMSTLDILKIHGGSAANFLDVGGSATEQQIQE
AVSLVLSDENVEVLFINIFGGIMDCSAVASGLVAVMQTRENLIPTVVRLEGTNVELGKEI
VQRSGIPCKFTDSLNTGAQLAVALSK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaataccaagctaaagacctcttagcctcttataatatagctattcct
ccttatcgtgtagcctcgtctgttgaagaaggtagacatacgctcaatgagttaggaatc
agcgcaggtgtggttaaagtacaagtacatgctggaggtagggggaaaaacggtggtgtc
attgttgcgaaatctcctgatgagattcttgcagctgtggataaattgttacgcatgcgt
tttaccagtaatcaaacttctggagaagctttacctgtagagaaagttctgatcacaccc
ttagtgaatattgctactgagtattacctagcagtaatcatggataggaaaaatcgctgc
ccagcgattatgttatcgagagccggaggtgttgatattgaagaggtagctcaaaaatat
cctgaccaattgcttactatacccctgactccttttgctcgtatatataattatcaactt
agacagatgattaaatttatgggttgggaaggcgatacagggaaacaaggcgtacagctg
attaaaagtcttgttcaatgtttctatgataatgacgcttctttactggaaattaatcct
ttagtgcttactcaagaaggagatcttcttgtactagatgctaaagtcactattgatgat
aacgccttataccgtcatccaaaacttgaagtattgtacgacccttctcaagaaaatgtt
cgtgatgtacttgctaagcagataggactttcctacattgctctagatggcaatattggg
tgcttagttaatggtgccggattagctatgagcacattagacattcttaagattcatgga
ggatctgcagcaaatttccttgatgtaggcgggagcgctacggaacaacaaattcaggaa
gccgtatctttagtgctatcagacgaaaatgtagaggttctttttatcaatattttcggt
ggcattatggattgttctgcagttgcctcgggacttgttgctgtgatgcaaactagggaa
aatctcattcctacagtagtgcgtttagaaggaacaaatgtagaacttggcaaagaaatt
gtacagcgttcaggaatcccctgtaaatttaccgattccttaaatacgggcgcacagctt
gctgtagcattaagtaaataa

DBGET integrated database retrieval system