KEGG   Chlamydia psittaci 6BC: CPSIT_1058Help
Entry
CPSIT_1058        CDS       T01481                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
chp  Chlamydia psittaci 6BC
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:chp00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1156923..1157366)
Genome map
AA seq 147 aa AA seqDB search
MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN
VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI
KGWRKTVLDEKENLTFCFYENFADCHS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa
actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag
tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat
gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt
cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt
ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc
aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa
aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system