KEGG   Chlamydia psittaci 6BC: CPSIT_1059Help
Entry
CPSIT_1059        CDS       T01481                                 

Gene name
folKP
Definition
folate synthesis bifunctional protein (EC:2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
chp  Chlamydia psittaci 6BC
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157404..1158747)
Genome map
AA seq 447 aa AA seqDB search
MITKHFICLSLGSNLGNRFENFRRAFSLLKELGIEDLQSSIILETKALLLPDSPKEWDLP
FFNSVLIGRTALSPKELLSGIKHIERKLGRDPNALPWSPRILDVDILLYGDENYQQDDII
IPHHRILERPFLLSLVASLCPTRKLHQPDSEFHLKTFGEIAHCLPCPQEIILNSFSPTTF
LMGIVNVTDNSISDGGLYIDPSKAVAHAERLFAQGASVIDFGAQATNPKIKQLIDVDQEW
ARLEPVLKLLAEKWSGCMQYPDVSLDTFYPEIIKRALEIYPIRWINDVSGGSKEMAEIAR
DANLLLVINHSCSLPPRPDKTLAFTTCASDQLLSWGKQQIEAFVALGLSKDQIIFDPGIG
FGTTPIQALNVLHRMEKFRELGCATLVGHSRKSCFSLLGKYDAKDRDWETVSLSVLLQQQ
GVNYLRVHDVEANHRVLSAAAWPGVYV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaagcattttatttgtttatctctaggttccaatctaggaaaccgttttgaa
aattttcgtagagcattttctcttttaaaagagttgggcatagaagatttacaaagttcc
ataattttggagacaaaggctttattgttgcctgactcaccaaaagaatgggacttgcct
ttttttaattccgtacttattggaaggactgcactatctccaaaggagttattgtcaggg
atcaaacatatagaacgtaagcttggtagagatcctaatgccttaccttggtctcctagg
attctggatgtggatattctgttatatggtgatgaaaattaccaacaggatgacatcatc
atacctcatcataggattttagaaagaccgttcttactttctcttgtggcatcgttatgc
cctactagaaaactccatcaaccagattctgaatttcacttaaaaacgtttggagaaata
gcccattgtctaccttgtcctcaggagattattctgaatagcttttctcctactactttt
ttaatgggcatagtgaatgttacggataactccatttctgacgggggattatatattgat
ccttctaaagctgttgctcatgcagagcgattatttgctcaaggggcttccgtaatagac
tttggtgcgcaagcaactaaccctaaaattaagcaattgattgacgtagatcaagagtgg
gcccgtttagagccggtactcaagcttttagcggaaaaatggtcaggatgtatgcaatat
ccagacgtttccttggatacattttatcctgagattattaagagagctttagaaatttat
ccaattcgatggataaatgatgtttctggcggctctaaagaaatggctgagattgccaga
gatgcgaatttattattagttatcaatcattcgtgttctcttcctccacgtcctgataaa
acgttagcttttaccacatgtgcttcagaccagttgctaagctggggaaagcagcaaatt
gaagcttttgttgctttgggattgagcaaagatcaaattatttttgacccaggaataggt
ttcggaacgactcccatacaagcattgaatgtattacacagaatggaaaaattccgagag
cttggttgcgctacgttggtagggcactcaaggaaatcgtgtttctctttgttggggaaa
tatgatgctaaagatcgtgattgggaaactgtgagcttatcggttttgttacaacagcaa
ggcgtgaattacttacgtgttcatgatgttgaagcaaaccacagggtcttatccgcagca
gcatggcctggggtttatgtgtaa

DBGET integrated database retrieval system