KEGG   Chlamydia psittaci RD1: Cpsi_1321Help
Entry
Cpsi_1321         CDS       T02153                                 

Gene name
ruvA
Definition
putative holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
chr  Chlamydia psittaci RD1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpsi_1321 (ruvA)
Enzymes [BR:chr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cpsi_1321 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124599..125267
Genome map
AA seq 222 aa AA seqDB search
MPRAYFCVYLFGSSVMYDYIRGVLTYISSGTMVVESQGLGFSIFAPDRWLMELSSQLHRE
LIVYTYTVVRETEHVLYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARA
EDIKAIASVPGIGKKTAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAAL
GYPKSSAERMIAEAMSELPDHASIAEILPIALKKNLQGLNKS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcgcatacttctgcgtatacttgtttgggagttcggtgatgtacgactatatt
cgtggtgtgcttacttatatcagttcaggaactatggtagttgaaagtcagggactgggg
tttagtatttttgctcctgatagatggcttatggaattgtcaagtcaactacaccgcgag
cttatagtctatacttatactgttgttcgtgaaactgagcatgttctctatggatttaat
actcgtggagaacgcgagtgtttccgtatgttaatttcattttcaggagtgggacctaag
acaggtttagcgattttaaatacattttctcttagcaaattgtgttctatagctcgtgct
gaggatatcaaagctatagcttctgttccgggtatagggaagaaaacagctgagaaactt
atggtggatttgaagcaaaagcttgcagacttactccctttagattcgcaaatcaccgct
tcttggggaccagcaaaaccttcttgtatggaagagggaatacaagctttagcagcatta
ggctatccaaaatcctcagcagagagaatgatcgccgaagctatgagcgagctcccggat
catgcgtcaatagcagaaattcttcctattgctctaaagaagaatttacaaggtttgaac
aagagctag

DBGET integrated database retrieval system