KEGG   Chlamydia psittaci RD1: Cpsi_4681Help
Entry
Cpsi_4681         CDS       T02153                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chr  Chlamydia psittaci RD1
Pathway
chr00010  Glycolysis / Gluconeogenesis
chr00020  Citrate cycle (TCA cycle)
chr00620  Pyruvate metabolism
chr01100  Metabolic pathways
chr01110  Biosynthesis of secondary metabolites
chr01120  Microbial metabolism in diverse environments
chr01130  Biosynthesis of antibiotics
chr01200  Carbon metabolism
Module
chr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpsi_4681 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Cpsi_4681 (pdhC)
   00620 Pyruvate metabolism
    Cpsi_4681 (pdhC)
Enzymes [BR:chr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cpsi_4681 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CBY16997
Position
complement(534223..535509)
Genome map
AA seq 428 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTANEEGWFRDCL
VKEGTKVHIGTPIAVISSEKDEDFNLDTILPKTPEPELPVENVQLVEEEVTKVQPSVAPM
QLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKEKNLDISGIKGSGPGGRIVEKDLD
KAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASPL
LALLKELQAQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNKIVRFETIDISIAVAIP
DGVITPIVRCADRKNIGMISAEIKSLASKAKSQSLKEEEYKGGSFCVSNLGMTGITAFTA
IINPPQAAILAVGSVQEEPIVINGEILVGSTCILTLSIDHRVIDGYPAAMFMKRLQKILE
APSILLLN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctcccaccatggaagtaggaactatcgta
aaatggcataagaacaatggcgataaaatagagtttggtgatgttctcttagaagtatca
acagataaggctgtactcgagcatacggcaaatgaagaaggctggttccgggattgtctt
gttaaagagggaacaaaagtacacataggcacacctatagctgtcatatcttcggaaaag
gatgaggatttcaacttagacactatccttcctaaaactcccgagccagaacttcctgta
gaaaatgttcaattagtggaagaagaagtcacgaaagtgcaaccatccgttgcccccatg
cagttagcctttcaatttaaacctgaacctcccctgtctaaacctctatctttaaaagta
gattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaaaaaacctg
gatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctggat
aaagctcctaccaaaggtattgcaggttttggttaccctgaagctcctgaagtgcatcct
ggatcctatcacgaggaaactctttctcctattcgagacatcattgcacagaggttacaa
gctgcgaaagcctctattccacatttttatgtaacacaaaaagtttatgcttcgccgttg
ctcgccctgcttaaggaactacaggcccaaggaattaagctgtctattaatgactgtatt
gttcgtgcttgcgccctagctttaaaagagtttcctgaagtaaattcaggcttcaatagc
gtcgacaataaaattgtacgttttgaaactatagatatttcgatagctgtggctattcct
gatggagtgattactcctattgtacgctgtgctgatcgcaagaacataggtatgatttct
gccgagattaaaagcttagcttctaaagcgaaatctcaatctttaaaagaggaagagtat
aaaggtgggtctttctgcgtttccaatttaggcatgacaggaattacagcattcacagca
attatcaatccccctcaagcagctattcttgctgtgggtagtgttcaggaagagccgata
gtaatcaatggagaaattctagttggttctacgtgtatattgacattgtctatagatcac
cgtgtaattgacggatatccagccgcaatgtttatgaagcgattgcagaaaatcttagaa
gctccttctatcctgttattaaattaa

DBGET integrated database retrieval system