KEGG   Chlamydia psittaci RD1: Cpsi_4751Help
Entry
Cpsi_4751         CDS       T02153                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
chr  Chlamydia psittaci RD1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpsi_4751 (recR)
DNA repair and recombination proteins [BR:chr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cpsi_4751 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(543015..543617)
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYLSKLISFLRKLPGIGFKTAEKLAFELLDWDKDQLESMGKAFSELSAARSHCPT
CFCLKSHPESLCSFCQNNRDTSILCIVATPKDIFALERSQIFKGHYYVLGALLSPITGKH
IDAERMHLLKQRIEFLKPKEIILALDATLEGDATALFLKQELSHSSISISRLALGLPIGL
SFDYIDSGTLARAFSGRNPY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagtatcctgactatttatccaaactcatctcctttcttagaaaactccctggg
ataggatttaaaacagcagaaaaactagctttcgaactattagattgggataaggatcaa
ttagaatccatggggaaagctttttccgaactctctgctgcacgcagccattgtcccact
tgtttttgcttgaaaagtcacccagaaagtctttgctcattttgtcaaaacaatcgagac
acatctatattgtgtatcgtagcaactcctaaagatatttttgctttagagcgctcccaa
attttcaaaggtcactattatgtcttaggagccttactatcgccaataacgggaaaacat
attgatgcagagagaatgcatttactaaaacaacgtatagaatttttaaaaccgaaagaa
attattctagctctagacgccactctagaaggagatgctacagcccttttcttaaaacaa
gagctttctcattcctccatatctatttctcgtttggctctaggtttgccaataggattg
tcttttgattatatagactccggaacgcttgctagagccttttctggccgaaacccatat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system