KEGG   Chlamydia psittaci RD1: Cpsi_5931Help
Entry
Cpsi_5931         CDS       T02153                                 

Definition
(GenBank) putative pyrophosphate-dependent phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chr  Chlamydia psittaci RD1
Pathway
chr00010  Glycolysis / Gluconeogenesis
chr00030  Pentose phosphate pathway
chr00051  Fructose and mannose metabolism
chr00680  Methane metabolism
chr01100  Metabolic pathways
chr01110  Biosynthesis of secondary metabolites
chr01120  Microbial metabolism in diverse environments
chr01130  Biosynthesis of antibiotics
chr01200  Carbon metabolism
chr01230  Biosynthesis of amino acids
chr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:chr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpsi_5931
   00030 Pentose phosphate pathway
    Cpsi_5931
   00051 Fructose and mannose metabolism
    Cpsi_5931
   00052 Galactose metabolism
    Cpsi_5931
  Energy metabolism
   00680 Methane metabolism
    Cpsi_5931
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cpsi_5931
Enzymes [BR:chr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cpsi_5931
Protein phosphatases and associated proteins [BR:chr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cpsi_5931
Messenger RNA biogenesis [BR:chr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cpsi_5931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CBY17116
Position
678518..680176
Genome map
AA seq 552 aa AA seqDB search
MHVNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTLDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TVEITEEFMESFKNSGGFNCIGTGRTNIITEENKARCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEDADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFIKFKLYRKIWALEDSYRFLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaactccaatgatctcaacgacgtagttatcccaggtactcctcccctcccg
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgctaagcttttcccgaatacctatgacagtccttacctaaaattt
acttcaggaactcttgaccaacctgttcgtccattaaaagtaggtgtgatgctatcggga
ggtcctgctcccggaggtcataatgttatttggggattacttcatagcttaaagaaaata
catcccgacagctcgctcattggctttcttaataacggccaagggattctcaataatcat
acagtagaaattaccgaagaattcatggagtctttcaaaaattccggaggattcaactgt
ataggcacaggaagaacaaacatcatcactgaagaaaataaagcccgatgcttaaaaaca
gtacaagctttagaccttgatggtttagtaattattggcggtgatggttcgaatacagca
acggctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgtc
ccaaaaactattgatggagatcttcaacatctatttttagaccttacctttggatttgat
tcagcaacaaaattttattcctccattattagcaacatttctagagatacgctatcttgc
aaagcgcattaccacgtgatcaagcttatgggacgctctgcatcgcacattgctttagaa
tgcactctacaaacccatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gtgcctctaaatacgataatccataaagtctgttcgatcattgctgatagagccgctatg
gggaaatactatgggattattcttattcctgaaggcattatcgaattcatccctgagatt
aacaaccttgttaaagaaatcgaaagaatccctgaagatgcggataaattttcttctcta
tcccgtgaatctcaaaaattactaaaaagcttcccagaaactatcgctaaacaactcctt
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccaccttgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcgtgcctacccacaaaattcgataatacctac
agctacgccctaggatatggcgcaggagttcttacgtataaccgctgcaacggctacctc
actgtcatcgaatcactgattaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaagaag
agtttaattgatattagcagtcctgcttttattaagtttaaactctatagaaaaatatgg
gctctagaagattcttatcgttttttaggaccattacaaattgacaccccgcccaactct
cattccgatcatttccctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaattcctgactgcgattattaa

DBGET integrated database retrieval system