KEGG   Chlamydia psittaci RD1: Cpsi_6371Help
Entry
Cpsi_6371         CDS       T02153                                 

Definition
putative guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
chr  Chlamydia psittaci RD1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:chr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cpsi_6371
Enzymes [BR:chr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cpsi_6371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(736342..736956)
Genome map
AA seq 204 aa AA seqDB search
MKDKVRVPFSPDHPLCVPKLFTISAPAGAGKTTLVRMLAQEFPDSFQKTLSLTTRAPRPE
EVPGVDYQFVSQEEFQRRLDNDDFLEWVALFGEYYGTSRLGIDEIWKSGRHAVAVIDVEG
ALVLRSKIPTVTIFISAPSQEELERRLKQRGSEQDTQRQERLQHSLIEQAAANKFEYVII
NDDLEKSYEVLKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagttcgtgttcctttttctcccgatcatcccctatgcgtaccaaaatta
tttactattagtgctcctgctggagctgggaaaacaacgctagtacgtatgttggctcaa
gaatttccagattcttttcagaagactttatcacttacaacacgagcacctcgtcctgaa
gaagttcctggagtagattatcagtttgtttctcaagaggagtttcaacgacgcttagac
aatgatgattttcttgagtgggtagcactttttggagagtattacggaacgagtcgttta
gggattgatgaaatttggaaatctgggagacacgcggttgcggttattgacgtggaagga
gctttggtcttgcggagtaaaattcccacagtgacgatttttatttctgcgccatctcag
gaagagctagaaaggcgtctaaaacaaagaggatcagaacaagatactcaaagacaagag
cggttgcagcatagtcttattgaacaagctgcggctaataaatttgaatacgtcattatc
aatgatgatttggagaaatcttacgaggttttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system