KEGG   Chlamydia psittaci RD1: Cpsi_8891Help
Entry
Cpsi_8891         CDS       T02153                                 

Definition
putative phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chr  Chlamydia psittaci RD1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpsi_8891
   01230 Biosynthesis of amino acids
    Cpsi_8891
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpsi_8891
  Energy metabolism
   00680 Methane metabolism
    Cpsi_8891
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpsi_8891
Enzymes [BR:chr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpsi_8891
Exosome [BR:chr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpsi_8891
  Exosomal proteins of melanoma cells
   Cpsi_8891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1035826..1036509
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPQHKHMSKIYSDEANHMIPLYRSSALNERMYGELQGKN
KKETAEQFGEEQVKLWRRSYKTAPPKGESLYDTGQRTIPYFHETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVISLELPTGKPIVYLWTGHTFERHPEPFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacggaaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatatccccctgagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaggcaatcaaagacctccccatagattgtatctttacctcctctcttgtgaggagttta
atgacggcattgcttgctatgacacatcacaattctaaaaaaatcccttacattgttcat
gatgatcctcaacacaagcacatgagcaagatctatagtgatgaagcaaaccacatgatc
ccgctttaccgttccagtgcactaaatgaaagaatgtacggagagctccaaggaaaaaat
aaaaaagaaaccgctgagcaatttggagaggagcaggtaaaattgtggagacgtagttat
aagactgcccctcctaaaggcgaaagtctttacgatactgggcaacgcactatcccctat
tttcatgaaactattttccctttgttgcaaaattcaaaaaatgtgtttgtgtctgcacat
ggaaattcattacgttcactcatcatggatatagaaaaattaagtgaagaagaggtaatc
tctttggagttacccacaggaaaacccatagtgtatttatggaccggtcacacattcgaa
cgacacccagaaccatttggttaa

DBGET integrated database retrieval system