KEGG   Chlamydia psittaci 01DC11: CPS0A_0199Help
Entry
CPS0A_0199        CDS       T01860                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:chs00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:chs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179583..180917
Genome map
AA seq 444 aa AA seqDB search
MAAAEVFGGCVLEGSVRVSGAKNSTTKLLVASLLSDRKCILRNVPDIGDVRLTVELCRSL
GSIIHWDKQAEVIEIHTPEIRMSEVSAQFSRVNRIPILLLGALLARCPEGVIVPCVGGDA
IGERTLNFHFEGLERLGAKVVYDGHGYQAAAPQGLVGAYITLPYPSVGATENLILASVRA
QGRTIIKNAALEVEILDLILFLQKAGVEITTDNDKTIEIFGCDDFYEVDHWVIPDKIEAA
SFGMAAVLTGGRIFVENAEQYLMIPFLKTLRSIGGGFSVTETGIEFFYNEPLKGGVVLET
DVHPGFLTDWQQPFSVLLSQAEGSSVIHETVHENRLGYLRGLQQMGANCELFYQCLSSKA
CRYATGNFPHSAVIHGATPLKASELVIPDLRAGFAYIMAALIAEGGPSLIRNTQLLDRGY
YNWVDKLNSLGAKIHLLSLDPVAF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgaagtttttggtggttgtgtgttagaaggttctgtgcgggtatctggg
gccaaaaactcgacaaccaagttactcgttgcgtcattattatcggatcgcaaatgcatt
ttacgtaatgtccctgatataggagatgtacgtttaactgttgaattgtgccgttcttta
ggttctataatacattgggataaacaagcagaagtcatagagattcatacacctgagatt
cgcatgtccgaagtgtccgcacagttttctcgggtgaatcgtattcctattttattatta
ggagctctactagctcgctgtccggaaggcgttattgtcccctgtgtcgggggagatgct
ataggggaaaggactctaaattttcattttgagggtttagaacggctaggggcaaaggtt
gtctatgacggacatggatatcaagctgctgctcctcaaggtcttgtcggagcgtacatt
actcttccttacccttctgtaggagctactgagaatttgatattagcttctgttcgcgct
cagggaagaacgatcatcaagaacgctgctttagaagtagaaatcttggatcttattttg
tttttgcaaaaagcaggagtggagatcactacagataatgataagacgatagaaattttt
ggttgtgatgatttttacgaagtagatcactgggtgatccccgataagatagaagcggct
tcatttggtatggctgccgtgcttaccggcgggcgcatttttgtagaaaatgccgagcaa
tatctgatgattccttttcttaaaaccttaaggtctataggaggagggttctcagtgaca
gaaacaggaatcgaattcttttataacgaaccattaaaaggtggtgttgtattagaaacc
gatgtacatcctggattccttacagattggcaacaacctttttcagttcttctctctcag
gcagaaggatcttctgtgattcatgaaaccgtgcatgagaatcggctagggtatttacgc
ggtttacagcaaatgggagcgaattgcgagctgttctaccagtgtttaagctcaaaggct
tgtcgttatgcaaccggaaattttccccatagtgctgtcattcacggagcgacaccattg
aaagcttctgaactggttattcccgatttgcgtgcaggatttgcctatattatggcagct
ctcattgcagagggtggaccttctttaatcagaaatacccagttgttagatcggggatat
tacaattgggtggacaaactgaactctttaggagcaaagatccacttgttgtccttagat
cccgtagcgttctaa

DBGET integrated database retrieval system