KEGG   Chlamydia psittaci 01DC11: CPS0A_0300Help
Entry
CPS0A_0300        CDS       T01860                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:chs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPS0A_0300 (glgB)
Enzymes [BR:chs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CPS0A_0300 (glgB)
Exosome [BR:chs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPS0A_0300 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287459..289642
Genome map
AA seq 727 aa AA seqDB search
MVERIVNSEDVSLLISGRQSNPHKFLGIVSENSSQDRIILFRPGAHSVVVELQGNIAHAQ
HHHSGIFSLTAPKGTLPQDYRIYHQNGLLAHDPYAFSPLWGEVDSFLFHQGTHYKIYERM
GAIPYDVQGISGVLFVVWAPHAQRVSVVGDFNFWNGLVNPLRKVSDLGVWELFIPGLEEG
TLYKWEIVSASGEVLIKTDPYGKSFDAPPHAVSRVVHSDRYTWHDAQWMEKRKNREDQPL
AIYEVHVGSWQWHEGKPLGYRELAKKLAAYCKEMHYTHVELLPVTEHPLNESWGYQVTGY
YAPTFRYGSPEDFQFFVDHLHSENIGVILDWVPGHFPTDGFALAHFDGEALYESIEHKEP
LHPHWHTYTFDYRCNEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRQEGEWSPN
IYGGRENLDAIEFLKHLNSVVHREFPGVWTFAEESTDFPNVTKPVAQGGLGFDYKWNLGW
MHDTFRYIQVDPMFRSYHHNDLTFSLWYAFNERYLLPLSHDEVVHGKGSLLQKMPGDNPW
TKFAHMRLLLSYHICQPGKKLLFMGGEFAQGKEWAPDSSLDWHLLDNSYHACLHRCVARM
NALYCDLPYFWKGDGKQESFHWVDFKDTENNVIAYYRFAGENRSSALLCIHHFSSGYFPS
YVLHCQDINTCQLLFNSDDICFGGSGKGNRQPVLCIDQHVSWGVDIELPPLATLIFYVRF
VNKQSLV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaggattgtcaactctgaagacgtgtccttattaatttctggaaggcagagt
aatcctcataagtttttagggattgtttctgaaaactcctcacaggatagaatcattctc
tttcgtcctggggcccattctgtagttgtcgaactgcagggaaatatagcgcatgcacaa
caccatcattcggggatattttctctaactgctcctaaggggactctccctcaggattat
cgtatctatcatcaaaatggcctattagctcacgatccttatgcgttttctcctttgtgg
ggagaagtagattcttttttatttcatcaaggtacgcactataagatttacgaacgtatg
ggagcgattccctatgatgttcagggaatttccggggtgctttttgtggtttgggctcca
catgcacaacgcgtatctgttgtcggtgattttaatttttggaatggtcttgttaatcct
ttgcgcaaagtctctgatttaggagtttgggaattatttatcccaggtcttgaagaagga
accctgtataaatgggaaattgttagcgcttccggagaggtgcttatcaaaactgaccct
tatgggaaaagttttgatgctcctcctcatgcagtatctcgcgttgtgcatagtgatcgc
tatacatggcatgacgcccagtggatggaaaaacgtaaaaacagagaagaccagccttta
gcaatttatgaggtgcatgtaggttcatggcagtggcatgagggtaaacctttaggatac
cgagagttagcaaagaaactcgctgcctattgcaaagagatgcattatacgcacgttgag
ctgttgccagttacagaacatcctttaaatgaatcttggggataccaagtaacaggatac
tacgcacctacatttcggtatggatcacctgaagattttcagttttttgtagaccacctt
catagtgaaaatatcggggtgattttagattgggtgcctgggcacttccccacggatggc
tttgctttagctcattttgacggagaagccctgtatgaatctatagaacataaagagcca
ttacacccccattggcatacgtatacttttgattatcgctgcaatgaagtcgtgaatttc
cttttaggcagcgctctattttggttagataaaatgcacatagatggtttacgtgtcgat
gctgtaacctcgatgttgtatttagattatggccgtcaagaaggagagtggtcccccaac
atctatggaggtagagagaatctcgatgctatcgagttcttgaaacacttgaattctgta
gtgcatagggaattccccggggtatggacatttgctgaggaatctacagatttcccgaac
gtgaccaagccggtcgcccaaggagggttagggttcgattataaatggaacttaggttgg
atgcacgatacctttcgttatattcaggtcgatcctatgttccgttcgtatcaccataat
gatctgacctttagcctttggtatgcctttaacgaaaggtacctccttcctctttctcat
gatgaggttgtccatggtaaaggtagccttttacaaaaaatgcctggtgataatccatgg
acaaagtttgcccatatgcgtttgctgttaagctatcacatatgccagccgggcaagaaa
ctgctgtttatgggtggggaatttgctcaaggaaaagaatgggctccggatagctcttta
gattggcatctgttagataactcctatcacgcttgtttacacaggtgcgtagcacggatg
aatgctttatattgtgaccttccttatttttggaaaggagatggtaagcaggagtctttc
cattgggtagacttcaaagatactgaaaataatgttatagcttactacagatttgcagga
gaaaatcgtagtagcgctttactgtgtatccaccattttagttcgggatattttccttct
tacgttctacattgtcaggacataaatacctgccaactcctttttaatagcgatgatatt
tgctttgggggttcagggaaaggcaaccgtcagccagttctttgcatagatcagcatgtc
tcttggggggtggatatcgagctgccccctctagcaactttgattttttatgttcgtttt
gtaaataaacaatctcttgtttaa

DBGET integrated database retrieval system