KEGG   Chlamydia psittaci 01DC11: CPS0A_0346Help
Entry
CPS0A_0346        CDS       T01860                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
chs00010  Glycolysis / Gluconeogenesis
chs00051  Fructose and mannose metabolism
chs01100  Metabolic pathways
chs01110  Biosynthesis of secondary metabolites
chs01120  Microbial metabolism in diverse environments
chs01130  Biosynthesis of antibiotics
chs01200  Carbon metabolism
chs01230  Biosynthesis of amino acids
Module
chs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0A_0346 (tpiA)
   00051 Fructose and mannose metabolism
    CPS0A_0346 (tpiA)
   00562 Inositol phosphate metabolism
    CPS0A_0346 (tpiA)
Enzymes [BR:chs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPS0A_0346 (tpiA)
Exosome [BR:chs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPS0A_0346 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPS0A_0346 (tpiA)
  Exosomal proteins of melanoma cells
   CPS0A_0346 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG86340
UniProt: A0A0E2IYK2
Position
361138..361902
Genome map
AA seq 254 aa AA seqDB search
MERKRYIFGNWKMHKTAKEAKDYLSVFCPLLEEVAPVSRVGITPAFTALHACCESIKSFH
SPLWLGAQNVHQDASGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAA
AREGIIPVLCIGETLEVREKGATEAMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVA
SAVDVQEAHAFCREVLANIFSKEKAEEISILYGGSVKADNAEGFARCPDVDGLLVGGASL
DPKVFADVVANFHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagcgttatattttcggtaattggaaaatgcataagacagctaaagaggct
aaagattatttgtctgttttctgccctctccttgaagaagttgctcctgtatctcgtgtg
ggtatcacccccgcattcacagcgttacatgcttgctgtgaatctataaagtcttttcac
agtcctctgtggctgggagcgcaaaatgtccatcaggatgcctcgggagcctttacaggt
gaaatttccttgcctatgctcaaagaatttgatgtcaattttgtacttttaggtcactcc
gaatgccgtcatatttttcatgaagaagatacgaccattgcgcttaaggttggtgccgca
gctcgtgaaggcattattcccgttctgtgtatcggagaaactctagaagttagagaaaaa
ggcgcgacggaagctatgttatctaaccagttgatgttggggcttgcgcaacttccggaa
actgcctctgtaatcattgcttatgaacccgtatgggcaattggtacgggtaaagtagct
tcagcggttgatgtgcaagaggcacatgccttttgtcgagaggtgcttgcgaatatattt
tccaaagagaaagctgaggagatttccattctttatgggggatctgtaaaggcagataat
gctgaaggatttgctcgttgtcctgatgtagacgggttgttagtaggaggcgcttcctta
gatcctaaagtttttgccgatgttgtcgcgaattttcatcgttag

DBGET integrated database retrieval system