KEGG   Chlamydia psittaci 01DC11: CPS0A_0851Help
Entry
CPS0A_0851        CDS       T01860                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
chs00020  Citrate cycle (TCA cycle)
chs00640  Propanoate metabolism
chs01100  Metabolic pathways
chs01110  Biosynthesis of secondary metabolites
chs01120  Microbial metabolism in diverse environments
chs01130  Biosynthesis of antibiotics
chs01200  Carbon metabolism
Module
chs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPS0A_0851 (sucC)
   00640 Propanoate metabolism
    CPS0A_0851 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CPS0A_0851 (sucC)
Enzymes [BR:chs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPS0A_0851 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEG86790
UniProt: A0A0E2IYK0
Position
complement(898359..899519)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYNIAIPPYRVASSVEEGRHTLNELGISAGVVKVQVHAGGRGKNGGV
IVAKSPDEILAAVDKLLRMRFTSNQTSGEALPVEKVLITPLVNIATEYYLAVIMDRKNRC
PAIMLSRAGGVDIEEVAQKYPDQLLTIPLTPFARIYNYQLRQMIKFMGWEGDTGKQGVQL
IKSLVQCFYDNDASLLEINPLVLTQEGDLLVLDAKVTIDDNALYRHPKLEVLYDPSQENV
RDVLAKQIGLSYIALDGNIGCLVNGAGLAMSTLDILKIHGGSAANFLDVGGSATEQQIQE
AVSLVLSDENVEVLFINIFGGIMDCSAVASGLVAVMQTRENLIPTVVRLEGTNVELGKEI
VQRSGIPCKFTDSLNTGAQLAVALSK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaataccaagctaaagacctcttagcctcttataatatagctattcct
ccttatcgtgtagcctcgtctgttgaagaaggtagacatacgctcaatgagttaggaatc
agcgcaggtgtggttaaagtacaagtacatgctggaggtagggggaaaaacggtggtgtc
attgttgcgaaatctcctgatgagattcttgcagctgtggataaattgttacgcatgcgt
tttaccagtaatcaaacttctggagaagctttacctgtagagaaagttctgatcacaccc
ttagtgaatattgctactgagtattacctagcagtaatcatggataggaaaaatcgctgc
ccagcgattatgttatcgagagccggaggtgttgatattgaagaggtagctcaaaaatat
cctgaccaattgcttactatacccctgactccttttgctcgtatatataattatcaactt
agacagatgattaaatttatgggttgggaaggcgatacagggaaacaaggcgtacagctg
attaaaagtcttgttcaatgtttctatgataatgacgcttctttactggaaattaatcct
ttagtgcttactcaagaaggagatcttcttgtactagatgctaaagtcactattgatgat
aacgccttataccgtcatccaaaacttgaagtattgtacgacccttctcaagaaaatgtt
cgtgatgtacttgctaagcagataggactttcctacattgctctagatggcaatattggg
tgcttagttaatggtgccggattagctatgagcacattagacattcttaagattcatgga
ggatctgcagcaaatttccttgatgtaggcgggagcgctacggaacaacaaattcaggaa
gccgtatctttagtgctatcagacgaaaatgtagaggttctttttatcaatattttcggt
ggcattatggattgttctgcagttgcctcgggacttgttgctgtgatgcaaactagggaa
aatctcattcctacagtagtgcgtttagaaggaacaaatgtagaacttggcaaagaaatt
gtacagcgttcaggaatcccctgtaaatttaccgattccttaaatacgggcgcacagctt
gctgtagcattaagtaaataa

DBGET integrated database retrieval system