KEGG   Chlamydia psittaci 01DC11: CPS0A_0884Help
Entry
CPS0A_0884        CDS       T01860                                 

Gene name
ispE
Definition
4-(5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:chs00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(940986..941861)
Genome map
AA seq 291 aa AA seqDB search
MDLFSPAKLNLFLKLHGKTAHGFHEMTTLYQVINFGDSLSLESSSEDSLICNLPELNTPQ
NLIWKSVQVFRDYTKIYSPVAWRLYKRIPIGSGMGGGSSNAATALYALNQHFQTQLSNDV
LQELGKKIGMDVPLFFSLGSALGIGCGEQILPYENDRGDERYVLYFSDQAVLTKDAFSYV
RPEDFSKREECLSLYERNNDLEKSVFRFRRDLEEKKDMLKRIWSPFDAHVSMSGAGATLF
VSYPKEIETDPSIVKAIHATIHNSQGMLVNSLRKYTGWFEHCDSLFTTTRQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttttctccagcaaaactcaatctctttttaaagcttcacggcaaaacagct
catggcttccacgagatgacaaccctataccaagtcatcaattttggagatagcctgagc
ttagagagtagtagtgaagattctcttatttgtaatctaccagaattaaatactcctcaa
aatctcatatggaaaagtgttcaggttttcagagactacaccaaaatctacagtcctgtt
gcttggcggttgtataagcgtattcctataggatctggtatgggaggcggcagtagcaat
gctgctacagcactctatgctttaaatcaacatttccaaacgcaactatccaatgatgtt
ctgcaagagctagggaaaaagattggcatggatgtccctctgttcttctcattgggatct
gctctaggcataggatgtggcgagcaaatccttccttacgaaaacgatcgtggcgatgaa
aggtatgtcctctatttctcagaccaagctgtcttgactaaagacgctttttcttatgta
cgccccgaagatttttctaaaagggaagaatgcttatctttatacgagagaaacaatgat
ttagaaaagtccgtgtttcgttttcgtagggatcttgaagagaaaaaagacatgctaaaa
aggatatggagtccttttgatgctcacgttagtatgtctggggccggggcaacgctattt
gtaagttatcccaaggaaatcgaaacagacccctccatagttaaagctatccatgcaact
atccacaatagccagggtatgctcgtaaatagcttacgcaaatacactggatggtttgag
cattgcgatagtctatttacaacaacaagacaataa

DBGET integrated database retrieval system