KEGG   Chlamydia psittaci 01DC11: CPS0A_0915Help
Entry
CPS0A_0915        CDS       T01860                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:chs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973160..974140
Genome map
AA seq 326 aa AA seqDB search
MPSHLLDYQRVAESIVEKTIAELIHYRQRLPLVPFWTKPDGSFVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVSDKHKINSILEFIHRLDSQVTPEDLLETLSPNQEASTLYWLVD
PIDGTSGFIKNRFFASAVSLIYEDKPILAVMACPCTDRHTFKIYSAAKNYGVSLFGTAIE
TRHYLKSGETLTGKFCEASLAARNQQHHATRLLSLSLPGQPQACRVDSQYKYAMVAEGAV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNSLNYRREDFILENHPIILASGN
AEIHRITLDALQEQANIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatttactagactatcaaagagttgcagaaagtatagttgagaaaaccatc
gccgagttaatccattatcgacaacgccttccgctagtccctttctggacaaaacccgac
gggtcttttgtcacacccgcagattatgctgtccaatactgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtaagcgataaa
cataaaattaatagtattttagaattcattcacagactagattcgcaggtgacacctgag
gatcttttagaaacattaagccccaatcaagaagcctcgactttatactggcttgttgat
cctattgatggtacgtcaggatttattaaaaaccgtttttttgcctctgcagtatcctta
atttatgaggataagcctatactcgcggttatggcgtgcccatgcacagaccgccatact
tttaaaatctattctgctgctaaaaactatggggtttctttatttggtacggcaattgaa
actcggcattatttaaaatctggagaaacgctaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccacgctacacgcttattaagtctctccttgccagggcaa
ccccaagcttgtcgagttgacagtcaatacaaatatgctatggttgctgaaggcgctgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggggcttttttagtagaagagtctgggggcgtagtttccgatatttttggaaattcgctc
aactatcgtcgagaagatttcattttagaaaaccatcccataattctagcttccgggaat
gcggaaattcacagaattacgttagacgccttacaagaacaagcaaacattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system