KEGG   Chlamydia psittaci 01DC11: CPS0A_0980Help
Entry
CPS0A_0980        CDS       T01860                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chs  Chlamydia psittaci 01DC11
Pathway
chs00010  Glycolysis / Gluconeogenesis
chs00260  Glycine, serine and threonine metabolism
chs00680  Methane metabolism
chs01100  Metabolic pathways
chs01110  Biosynthesis of secondary metabolites
chs01120  Microbial metabolism in diverse environments
chs01130  Biosynthesis of antibiotics
chs01200  Carbon metabolism
chs01230  Biosynthesis of amino acids
Module
chs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0A_0980
  Energy metabolism
   00680 Methane metabolism
    CPS0A_0980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS0A_0980
Enzymes [BR:chs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPS0A_0980
Membrane trafficking [BR:chs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CPS0A_0980
Exosome [BR:chs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPS0A_0980
  Exosomal proteins of melanoma cells
   CPS0A_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEG86902
UniProt: A0A0E2IWZ9
Position
1043850..1044533
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPQHKHMSKIYSDEANHMIPLYRSSALNERMYGELQGKN
KKETAEQFGEEQVKLWRRSYKTAPPKGESLYDTGQRTIPYFHETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVISLELPTGKPIVYLWTGHTFERHPEPFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacggaaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatatccccctgagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaggcaatcaaagacctccccatagattgtatctttacctcctctcttgtgaggagttta
atgacggcattgcttgctatgacacatcacaattctaaaaaaatcccttacattgttcat
gatgatcctcaacacaagcacatgagcaagatctatagtgatgaagcaaaccacatgatc
ccgctttaccgttccagtgcactaaatgaaagaatgtacggagagctccaaggaaaaaat
aaaaaagaaaccgctgagcaatttggagaggagcaggtaaaattgtggagacgtagttat
aagactgcccctcctaaaggcgaaagtctttacgatactgggcaacgcactatcccctat
tttcatgaaactattttccctttgttgcaaaattcaaaaaatgtgtttgtgtctgcacat
ggaaattcattacgttcactcatcatggatatagaaaaattaagtgaagaagaggtaatc
tctttggagttacccacaggaaaacccatagtgtatttatggaccggtcacacattcgaa
cgacacccagaaccatttggttaa

DBGET integrated database retrieval system