KEGG   Chlamydia psittaci 08DC60: CPS0D_0134Help
Entry
CPS0D_0134        CDS       T01862                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cht  Chlamydia psittaci 08DC60
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cht00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPS0D_0134 (ruvA)
Enzymes [BR:cht01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPS0D_0134 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124643..125266
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGVLTYISSGTMVVESQGLGFSIFAPDRWLMELSSQLHRELIVYTYTVVRETEHV
LYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDIKAIASVPGIGKK
TAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAALGYPKSSAERMIAEAM
SELPDHASIAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggtgtgcttacttatatcagttcaggaactatggtagttgaa
agtcagggactggggtttagtatttttgctcctgatagatggcttatggaattgtcaagt
caactacaccgcgagcttatagtctatacttatactgttgttcgtgaaactgagcatgtt
ctctatggatttaatactcgtggagaacgcgagtgtttccgtatgttaatttcattttca
ggagtgggacctaagacaggtttagcgattttaaatacattttctcttagcaaattgtgt
tctatagctcgtgctgaggatatcaaagctatagcttctgttccgggtatagggaagaaa
acagctgagaaacttatggtggatttgaagcaaaagcttgcagacttactccctttagat
tcgcaaatcaccgcttcttggggaccagcaaaaccttcttgtatggaagagggaatacaa
gctttagcagcattaggctatccaaaatcctcagcagagagaatgatcgccgaagctatg
agcgagctcccggatcatgcgtcaatagcagaaattcttcctattgctctaaagaagaat
ttacaaggtttgaacaagagctag

DBGET integrated database retrieval system