KEGG   Chlamydia psittaci 08DC60: CPS0D_0501Help
Entry
CPS0D_0501        CDS       T01862                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cht  Chlamydia psittaci 08DC60
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cht00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPS0D_0501 (malQ)
Enzymes [BR:cht01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CPS0D_0501 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(513888..515480)
Genome map
AA seq 530 aa AA seqDB search
MTPFSKALRYIQDSPAKHNWKPLGTMPKHGICVPLFSLHTKNSCGIGEFLDLLPLISWCQ
KHKLQIIQILPINDSGEDSSPYNSISSVALNPLYLSLASLPHVQSIPHAQSKLKTMQALS
QLPYVHYPQVKVAKWEFLQDYYQYVVKIGALKDEEFLIFCEKEKYWLRPYTVFRSIKSYL
KGAPINNWAKAYTDRTNFSKFEKQFQKECEFFSYLQFLCFQQMSQVKSYADDHQILLKGD
LPILISKDSCDVWYYRQFFSSSGSAGAPPDIYNIEGQNWHLPVYHMHNLAQDNYTWWKAR
LRYAENFYSLYRLDHIVGFFRLWVWDSSGNGKFQPEDASEYLRQGTDILKHILRASRMLP
IGEDLGSVPSDIKHTLLKLGICGTRIPRWERNWEGDGSFIPLDQYSPLSVTSLSTHDSDT
LALWWRHAPKEARKFAKFLGIPFTPVLSEEDQKHILKVSHKTSSIFHINLINDYLALCPD
LVSDNLKYERINIPGTVSKNNWVYRIKPSMEEIVTHDAFNAHLSEIFADL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacgccattttctaaagctttacgctatattcaagactctccagctaagcacaactgg
aaacctttaggcaccatgcccaagcatggaatttgtgttccgttattttctctacatacc
aaaaatagctgtggcattggcgaattcttagatctccttcctctgatttcttggtgccaa
aaacataagttacagatcatacagattcttcctattaacgatagcggtgaagatagtagc
ccttacaacagcatatcttcagtcgctctcaatcctctttatctttccttagcaagcctt
ccccacgttcagtctattccccatgctcagtctaagttaaagacaatgcaagcactatct
caacttccttatgtgcactacccacaagtcaaagttgcaaaatgggaatttcttcaagac
tactatcaatacgtagtaaaaatcggtgctttaaaagatgaagaatttctgatcttttgt
gaaaaagaaaaatattggctacgtccctatacagtattccgttctataaaatcctatctc
aaaggagctccaataaataactgggcaaaagcctatacggataggacaaacttctcaaaa
tttgagaaacaattccaaaaagaatgcgagtttttctcctatctccaattcctgtgcttt
cagcaaatgtctcaagtaaaatcctatgctgatgatcatcagattctacttaaaggcgat
cttcctattctcattagtaaggatagttgtgacgtttggtactatagacaattcttttcc
tcatcaggatcggcaggcgctcctcccgatatttacaatattgaagggcagaattggcac
cttcccgtttatcatatgcacaatttagcccaagataattacacctggtggaaagcacgt
ctccgctacgctgagaatttctactctctatacaggcttgatcatatcgtaggattcttt
cgtctatgggtgtgggactcttcaggaaatggaaagtttcaaccagaagatgcgagtgaa
tatcttcgccaaggcacagacatactgaagcacatactacgcgcatcccgcatgctccct
ataggagaagatttaggaagcgtgccttctgatataaaacacaccttgttaaaactaggc
atatgcggcacacgcattcctcggtgggaacgcaattgggaaggtgatgggagtttcatt
cccttagatcaatactcccctctatcagtgacttcattatccacacatgattcggataca
cttgctctttggtggcgacatgccccgaaagaagctcgaaaatttgcaaaatttttagga
ataccttttactcctgtcctctctgaggaagatcaaaaacatatcctaaaagtttctcac
aaaacatcatctatttttcatattaacttaattaacgactacctcgcactttgccctgat
ttagtatctgacaatctaaaatacgaacgcataaatataccgggaacagtatcaaaaaat
aattgggtatatagaatcaagccttccatggaagaaatagtcactcatgatgcgttcaat
gcgcatctctccgaaatatttgctgatctttaa

DBGET integrated database retrieval system