KEGG   Chlamydia psittaci 08DC60: CPS0D_0522Help
Entry
CPS0D_0522        CDS       T01862                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cht  Chlamydia psittaci 08DC60
Pathway
cht00010  Glycolysis / Gluconeogenesis
cht00020  Citrate cycle (TCA cycle)
cht00620  Pyruvate metabolism
cht01100  Metabolic pathways
cht01110  Biosynthesis of secondary metabolites
cht01120  Microbial metabolism in diverse environments
cht01130  Biosynthesis of antibiotics
cht01200  Carbon metabolism
Module
cht_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cht00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0D_0522
   00020 Citrate cycle (TCA cycle)
    CPS0D_0522
   00620 Pyruvate metabolism
    CPS0D_0522
Enzymes [BR:cht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CPS0D_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEG88452
Position
complement(539566..540852)
Genome map
AA seq 428 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTANEEGWFRDCL
VKEGTKVHIGTPIAVISSEKDEDFNLDTILPKTPEPELPVENVQLVEEEVTKVQPSVAPM
QLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKEKNLDISGIKGSGPGGRIVEKDLD
KAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASPL
LALLKELQAQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNKIVRFETIDISIAVAIP
NGVITPIVRCADRKNIGMISAEIKSLASKAKSQSLKEEEYKGGSFCVSNLGMTGITAFTA
IINPPQAAILAVGSVQEEPIVINGEILVGSTCILTLSIDHRVIDGYPAAMFMKRLQKILE
APSILLLN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctcccaccatggaagtaggaactatcgta
aaatggcataagaacaatggcgataaaatagagtttggtgatgttctcttagaagtatca
acagataaggctgtactcgagcatacggcaaatgaagaaggctggttccgggattgtctt
gttaaagagggaacaaaagtacacataggcacacctatagctgtcatatcttcggaaaag
gatgaggatttcaacttagacactatccttcctaaaactcccgagccagaacttcctgta
gaaaatgttcaattagtggaagaagaagtcacgaaagtgcaaccatccgttgcccccatg
cagttagcctttcaatttaaacctgaacctcccctgtctaaacctctatctttaaaagta
gattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaaaaaacctg
gatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctggat
aaagctcctaccaaaggtattgcaggttttggttaccctgaagctcctgaagtgcatcct
ggatcctatcacgaggaaactctttctcctattcgagacatcattgcacagaggttacaa
gctgcgaaagcctctattccacatttttatgtaacacaaaaagtttatgcttcgccgttg
ctcgccctgcttaaggaactacaggcccaaggaattaagctgtctattaatgactgtatt
gttcgtgcttgcgccctagctttaaaagagtttcctgaagtaaattcaggcttcaatagc
gtcgacaataaaattgtacgttttgaaactatagatatttcgatagctgtggctattcct
aatggagtgattactcctattgtacgctgtgctgatcgcaagaacataggtatgatttct
gccgagattaaaagcttagcttctaaagcgaaatctcaatctttaaaagaggaagagtat
aaaggtgggtctttctgcgtttccaatttaggcatgacaggaattacagcattcacagca
attatcaatccccctcaagcagctattcttgctgtgggtagtgttcaggaagagccgata
gtaatcaatggagaaattctagttggttctacgtgtatattgacattgtctatagatcac
cgtgtaattgacggatatccagccgcaatgtttatgaagcgattgcagaaaatcttagaa
gctccttctatcctgttattaaattaa

DBGET integrated database retrieval system